KEGG   Xenopus tropicalis (western clawed frog): 496968Help
Entry
496968            CDS       T01011                                 

Gene name
ctrb2, ctrl
Definition
chymotrypsinogen B2 (EC:3.4.21.-)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 263 aa AA seqDB search
MALLFLLSCIVLIGSTYGCGVPAIKPIISGYARIVNGENAVSGSWPWQVSLQDRTGFHFC
GGSLVNNLWVVTAAHCGVTTSHRVILGEYDRSSSAEPIQTMSISRVFKHPNYNTNTMIND
ITLLKLSSTASFNSRVAPVCIPTSSEVFNSPERCITTGWGYVDAYSKLSPNKLQQVTLPL
LSNTECQRYWGNKIHSTMICAGASGASSCMGDSGGPLVCARNGAWVLAGIVSWGSSTCSP
SSPGVYARVSTLRSWMDQIVASN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcttttcctcctctcctgcattgtccttattggaagtacttatggctgcggt
gtccctgccatcaagcccattatttctggatatgccagaattgtgaatggtgagaatgca
gtctctgggtcctggccatggcaagtgtctctacaggacagaactggattccatttctgc
ggcggctccttggtgaataatttatgggttgtaactgctgctcattgtggtgtcacaacc
tcccatcgtgttatcctgggtgaatatgatcgttcttcatcagctgagccaattcaaacc
atgtctatttccagggttttcaaacatccaaattacaacaccaatactatgatcaatgac
attactttgttgaaactgtccagtactgcctctttcaacagccgtgtcgctcctgtctgt
atccctacctccagtgaagtctttaattctcctgaaagatgtatcacaacaggatgggga
tatgttgatgcatactcaaaattatctccaaacaagcttcagcaagttacactgcctctt
ctctccaacactgaatgtcagaggtactggggaaataagattcatagcaccatgatttgt
gctggagcatctggtgcctcctcctgcatgggtgactctggtggaccacttgtgtgcgca
agaaatggagcttgggtgttggctggcattgtgtcctggggaagttctacttgctctcca
tcatctcctggagtatatgctcgtgtctcaactcttagatcctggatggatcagattgtt
gcttccaattaa

DBGET integrated database retrieval system