KEGG   Xenopus tropicalis (western clawed frog): 496994Help
Entry
496994            CDS       T01011                                 

Gene name
cpb1, cpb2, pasp, pcpb
Definition
carboxypeptidase B1 (tissue)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     496994 (cpb1)
Peptidases [BR:xtr01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   496994 (cpb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 836 aa AA seqDB search
MLNMLNLSNLWPKQKGSRRQSLTDGWKGILGNITPTIFIPKVLCTRLINNGICTLKYLDF
WLPDSAQLVEQGKRADFHADGHVSYEVQALLQQSGMPYEILINDLQDALEKQRDSNIRAV
HSYEKYNDLDTINAWSANIAAQNPGLVSRSSIGTSYQGRPIYLLKVGKSGANKKAVFIDC
GFHAREWISPAFCQWFVKEAVSAYGVESEFTSLLDNLDIYVLPVLNVDGYVYTWTTNRMW
RKTRSANPNSTCIGTDPNRNFNAGWCTAGASTRACDETYCGSAPESEPETKALANFIRAN
IPAIKGYLTIHSYSQMLLFPYSYSYAVAKDHNELNAVAQGAVNSLTSLYKTKYTYGPGGS
TIYSSQVDIPACRQIILEGGSWRARRNRRTVFFPRLSEWAEQAGRQKTRKCQKSKRNMKI
VILFVVIVASLAAPFIRRFDNEKALRVFPQNEEDVQFIKHLARVMQLNFWKPHSSSYVIP
KAFVDFHANAEDSHIITGLLEEKGIKHRILFQNLQEAIENQLSKAGNPKDERFPSPRYRT
WLEISTWAYRVSVKYPNLVSVVQAGNTYEGQTILVLKVGSQSAHKKGIVLECGVHAREWI
SPAFCQWFVNEAIRSYGKDKAMTKLLNSVTFHVVPVFNVDGYIWTWTHDRMWRKNRYQDA
NNKCVGVDLNRNFNASWGTGFSNDEPCSEIYAGSGPESENETKAVASYIRDNISSLKAYI
SFHAYGQMLMYPYGYKSEKPPNSKKLDKIAVSALKALSTLYGTSYTHGPIATTIYPVSGS
SIDWAYDEGMKYSFAFELRDEGQYGFLLPENQIKKTCMETMLAVKAIAKSVVTRDI
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacatgttgaacttatcaaatctatggcccaaacagaaggggagtaggaggcag
tcactgaccgatgggtggaagggaatactgggcaatattactcctacaatcttcattcct
aaagtcctgtgcacaaggcttataaataatggcatatgtacactgaaatatcttgatttc
tggctccctgactcagcacaacttgtagaacaaggaaaacgagctgattttcatgctgat
ggtcatgtctcatatgaggttcaggcccttctccagcaaagtgggatgccctatgaaata
ttgattaatgatctgcaagatgccctagaaaagcagcgcgacagcaacatcagggctgtt
cacagttatgagaaatacaatgatcttgatacgattaatgcctggtctgccaacattgct
gctcagaacccaggacttgtgtctcgttcctcgataggaacctcatatcaaggccgtcct
atttacttgctcaaggttggaaaaagcggtgcaaacaagaaagctgtattcatagactgt
gggtttcatgctagggaatggatctcccctgctttctgccagtggtttgttaaagaggct
gtgagtgcatatggcgttgaatctgagtttacctctctgctcgacaacctggacatctat
gttttgccagtattgaatgttgatggttacgtctacacctggaccactaaccgtatgtgg
aggaagactcgttcagctaaccccaacagcacttgcattggaactgacccaaacagaaac
tttaatgctggctggtgcactgctggagcctcaacaagagcctgtgatgaaacatactgt
ggctctgctcctgaatctgaaccagagacaaaggctttggctaacttcatccgcgcaaac
attcctgcaatcaagggttaccttactatccattcttatagccagatgttgctgttcccc
tattcctacagttatgcagttgctaaagatcacaatgaactgaatgcagttgctcaggga
gcagttaacagtctgacttcactgtacaaaaccaagtacacttacggtcccggaggatca
acaatctatagcagccaggtggacataccagcttgcaggcagatcatcctggaaggtgga
agctggagggcacgcagaaaccggaggacagtcttctttcccagattaagtgagtgggcg
gagcaagcagggaggcagaagaccaggaaatgtcagaagtctaagagaaacatgaaaatc
gttatactttttgtcgttatcgtagcatctcttgctgctcccttcattcgccgctttgac
aatgaaaaagcattacgtgtctttccacaaaatgaagaggatgttcagttcatcaaacat
ttggccagagttatgcagcttaatttttggaagcctcattcatcatcttatgtgatcccc
aaagcctttgtggattttcatgcaaacgctgaggactctcacattatcactggccttctt
gaggaaaaaggaattaaacacagaattctttttcagaatttacaagaagctattgaaaac
caactaagtaaagctggtaatcccaaggatgaacgttttcctagccctagataccgaaca
tggttagagatttcaacctgggcttatcgtgtttctgtcaagtacccaaatctggtatct
gttgtgcaagctggaaacacttatgaaggacagactatactagttctcaaggttggaagc
caaagtgctcataaaaaaggcattgtcctggaatgtggtgttcacgcgcgagaatggatc
tctcctgctttctgccaatggtttgtaaatgaggcaatcagaagttatggaaaagataaa
gctatgacaaagctcttgaatagtgtgactttccacgttgttcctgtatttaacgttgac
ggctatatctggacatggactcatgatcgtatgtggagaaagaaccgttaccaggatgct
aataataaatgtgttggagtggatcttaataggaacttcaatgcttcctggggcactgga
ttttctaatgatgagccatgttcagaaatctatgcggggtctggcccagagtctgaaaac
gaaacaaaagctgtggcttcttacattcgtgacaatatctcatctctaaaagcatatatc
agtttccatgcatatggacagatgcttatgtatccttatgggtataaatctgaaaaacca
cctaatagtaaaaaactggacaaaattgctgtttctgcattgaaggctttatccaccctg
tatggcactagctacacacatggacccatcgctactacaatttatccagtttctggttct
tccatcgactgggcgtatgatgaaggaatgaaatactcctttgcgtttgagttacgggat
gaaggccaatatggctttctgcttcctgaaaaccaaataaaaaaaacttgtatggagacc
atgctggctgtgaaagcaattgccaaatctgttgtcacccgggacatttag

DBGET integrated database retrieval system