KEGG   Xenopus tropicalis (western clawed frog): 497006Help
Entry
497006            CDS       T01011                                 

Gene name
cpa1, cpa
Definition
carboxypeptidase A1 (pancreatic)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     497006 (cpa1)
Peptidases [BR:xtr01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   497006 (cpa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 420 aa AA seqDB search
MKGILALLALVVAASSLENFSGQQVLRIFPSDEAQVNLVRALEDEEYLQLDFWTSPSRVL
LPIDIRVPLHHLQSVKVYLESNSIQYSIMIHDVQNLLDEEQRDMRRNRASEDGRSTNSFN
YAAYHTFDEINAFIDNLVSENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIH
SREWVTQASAVWFAKKIVTDFGKDPSLTNTLNQMDILIEIVTNPDGFVYTHKSDRMWRKT
RSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIVDFVKSHGNI
KGFVSIHSYSQMLLFPYGYTNTRVPDHDELNAVSKKAITALASLYGTAYTYGSIISTIYQ
ASGGTIDWTYNQGIKHSYSFELRDTGRYGFALPANQIIPTAEETWLALTILIEHTRDNLY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcatactagcgttactcgctctggtggtagcagcctccagcttggagaatttc
agtggacaacaagtcctccgaattttccctagtgatgaggctcaggtgaacctggtgagg
gcgctggaagatgaggagtatttacagctcgatttttggacaagcccctcaagagttctt
ttacccattgatatcagagttccactccaccatctgcaatcagtgaaagtctacctggag
tccaacagtatccagtacagcatcatgattcacgatgtacagaacttgctggatgaagag
caacgcgatatgagacgtaatcgtgcctctgaggatggaaggtctactaacagcttcaat
tatgctgcctatcatacatttgatgagatcaacgcctttatcgacaacttggttagtgaa
aatccaaatttggttagcaaaatacagatcggttcaagttatgaaggccgtcctcttaat
gttctgaagttcagcacaggtcccaaccgcccagctttctggattgacactggtatccat
tcccgtgaatgggtcactcaggccagtgctgtctggtttgccaaaaagattgtcacagat
tttggtaaagatccatccttgacaaatacactgaaccaaatggatatcctcatcgaaatt
gtgaccaaccctgatggctttgtttacactcataaatcggatcgtatgtggcgtaaaacc
agatctccaaattctggctcactctgtgttggaactgaccccaacagaaactgggatgca
ggttttggaggtcctggctctagctcaaatccctgcactgaaacctacagaggacgtgct
gctcattctgaacctgaagtgaaagccattgtggactttgtgaaaagccatggcaacatc
aaaggctttgtctccattcacagctactcccagatgcttctcttcccatacggatacact
aatacccgagtacccgaccacgatgagctgaatgctgtgtcaaagaaagctattactgcc
ttggcttcactgtacggtacagcttacacctatggcagcatcatcagtaccatctaccaa
gcaagcgggggaaccattgactggacctacaatcaaggaattaagcattcctacagcttt
gagctgcgtgatactgggcgctatggatttgcactaccagctaaccaaatcattccaact
gcagaggagacatggcttgcactcactatacttattgagcatacccgtgataacctttat
taa

DBGET integrated database retrieval system