KEGG   Xenopus tropicalis (western clawed frog): 541454Help
Entry
541454            CDS       T01011                                 

Gene name
capn1
Definition
calpain 1, (mu/I) large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    541454 (capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    541454 (capn1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     541454 (capn1)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C2: calpain family
   541454 (capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 704 aa AA seqDB search
MMPFGGIASKLKIERLKASGVGSHDCAVRYQNQDYESLKQQCRESGSLFEDPNFPPIGSS
LGFKELGPGTSKTKGVQWKRPHDIADDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EDLLHRVVPHGQGFQDDYAGIFHFQIWQFGEWVDVVIDDRLPVKDGELVFVHSAECSEFW
SALLEKAYAKLNGSYEALSGGSTTEGFEDFTGGVAEMYELRKAPRNLDKIIKRALDRGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTALREVNYMGGVEKLIRIRNPWGQVEWTGAW
SDNSSEWNEVDPSEQEDLQLKMEDGEFWMSFQEFLRQFSRLEICNLTPDALDKDGQSKWH
STLYDGTWRRGSTAGGCRNNPATFWINPQFKVTLLEEDDDPDDNELACSFLVALMQKNRR
KERKVGQDMHTIGFAVYEVPDEFRGCQNVHLKKDFFLRHQSCARSETFINLREVSTQIRL
PPGEYIIVPSTFEPHKEADFVLRIFTEKHSDIQELDEEVSADLPEEEELTEDDVDDSFKA
MFRQLAGEDMEISVFELKTILNRVVAKHKDLKTDGFGMEACRQMVNLMDKDGSGKLGVVE
FQILWNKIRQWLTAFRQHDLDKSGTISAYELRIALEGTGYKLNNKLIQVLVARYADSDMG
IDFDNFVCCLVKLEAMFRFFKALDQGEGTAEMSLGEWLTMTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgttcgggggtatagcatcgaagctgaagatcgagcggctgaaggcgtcgggc
gtgggctcccacgattgtgccgttcggtaccagaaccaggactacgagagcctgaagcag
cagtgccgggagagcggcagcctcttcgaagatccaaacttcccgcccattggctcctcc
ctgggcttcaaggaactgggccccggaaccagcaaaactaagggggtgcaatggaaacgg
ccccatgatattgctgatgatccgcagtttattgttggtggagccaccaggacagacata
tgccagggggcactgggggactgctggctccttgctgcaattggctccctgacgctcaat
gaggatttgctgcacagggtggttccgcatgggcagggcttccaggatgactacgccggg
atcttccacttccagatctggcagtttggcgagtgggtggatgtggtgatagacgaccgt
ttgccggtgaaggacggggagttggtgtttgttcactcggccgagtgctcggagttctgg
agcgccctgctggagaaggcctacgccaagttgaacggttcctacgaggccctgtcgggg
ggcagcaccaccgagggattcgaggactttaccgggggagtcgcggaaatgtacgaattg
cgcaaagccccccggaacctggataagatcattaaacgggcgctggacagggggtcccta
ttggggtgctccatagacataacgagtgcctttgacatggaagccgttacatttaagaag
cttgtgaagggccacgcctactcggtcacggcactcagagaggttaattacatggggggg
gtggaaaagctgatccgcatccggaacccctgggggcaggtggaatggaccggcgcctgg
agtgataactcctcagaatggaatgaagtggacccttcagagcaggaggatctgcagtta
aagatggaggatggagagttctggatgtctttccaggaattcctgcgccagttttcccgg
ctggagatctgtaacctgacgccggacgcgctggacaaggacgggcagagcaagtggcac
agcaccctgtacgacgggacgtggcgccggggcagcaccgccgggggctgcaggaacaac
ccagccacattctggattaacccccagttcaaggtgaccctgctggaggaggacgatgac
cccgatgacaacgagttggcctgcagtttcctggtggcgctgatgcagaagaaccggcgg
aaggagcgcaaggtcggccaggacatgcacaccattggctttgctgtgtatgaggttccg
gatgagttccgggggtgccagaatgtgcatctgaagaaggatttcttcctgcgccaccag
tcctgcgcccgctccgaaaccttcattaacctgcgggaggtgagcacccagatccgcctg
ccccccggcgagtacatcatcgtgccctccaccttcgagccccacaaggaggcagatttt
gtcctgagaatattcactgagaaacattcagatatacaggagctggatgaggaggtatcg
gcagatcttcctgaggaggaggaactcacagaagacgatgtggacgattcgtttaaggcc
atgttccgccaactggcaggggaggacatggagatcagtgtgtttgagctgaagacgatc
ctgaacagagtggtggccaaacacaaagatctgaagacggacggtttcgggatggaggcc
tgcaggcagatggtcaatctgatggacaaagacggcagcggcaaactgggcgtggtcgag
tttcagatcctgtggaacaaaattcgccaatggctgacagctttccgacaacacgacctg
gacaagtcgggcaccatcagcgcctacgagctgcgcatcgccctggagggtacagggtac
aaactgaataacaaactcattcaggttctggtcgctcgctacgcggattccgacatggga
atcgacttcgataacttcgtctgctgcctcgtgaagctggaggccatgttccggttcttc
aaggcgttggaccaaggggagggcacagccgagatgagtttaggggagtggctgacgatg
accatgtgtggataa

DBGET integrated database retrieval system