KEGG   Xenopus tropicalis (western clawed frog): 541454Help
Entry
541454            CDS       T01011                                 

Gene name
capn1
Definition
(RefSeq) calpain 1, (mu/I) large subunit
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    541454 (capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    541454 (capn1)
   04217 Necroptosis
    541454 (capn1)
   04218 Cellular senescence
    541454 (capn1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     541454 (capn1)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C2: calpain family
   541454 (capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 704 aa AA seqDB search
MMPFGGIASKLKIERLKASGVGSHDCAVRYQNQDYESLKQQCRESGSLFEDPNFPPIGSS
LGFKELGPGTSKTKGVQWKRPHDIADDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EDLLHRVVPHGQGFQDDYAGIFHFQIWQFGEWVDVVIDDRLPVKDGELVFVHSAECSEFW
SALLEKAYAKLNGSYEALSGGSTTEGFEDFTGGVAEMYELRKAPRNLDKIIKRALDRGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTALREVNYMGGVEKLIRIRNPWGQVEWTGAW
SDNSSEWNEVDPSEQEDLQLKMEDGEFWMSFQEFLRQFSRLEICNLTPDALDKDGQSKWH
STLYDGTWRRGSTAGGCRNNPATFWINPQFKVTLLEEDDDPDDNELACSFLVALMQKNRR
KERKVGQDMHTIGFAVYEVPDEFRGCQNVHLKKDFFLRHQSCARSETFINLREVSTQIRL
PPGEYIIVPSTFEPHKEADFVLRIFTEKHSDIQELDEEVSADLPEEEELTEDDVDDSFKA
MFRQLAGEDMEISVFELKTILNRVVAKHKDLKTDGFGMEACRQMVNLMDKDGSGKLGVVE
FQILWNKIRQWLTAFRQHDLDKSGTISAYELRIALEGTGYKLNNKLIQVLVARYADSDMG
IDFDNFVCCLVKLEAMFRFFKALDQGEGTAEMSLGEWLTMTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgttcgggggtatagcatcgaagctgaagatcgagcggctgaaggcgtcgggc
gtgggctcccacgattgtgccgttcggtaccagaaccaggactacgagagcctgaagcag
cagtgccgggagagcggcagcctcttcgaagatccaaacttcccgcccattggctcctcc
ctgggcttcaaggaactgggccccggaaccagcaaaactaagggggtgcaatggaaacgg
ccccatgatattgctgatgatccgcagtttattgttggtggagccaccaggacagacata
tgccagggggcactgggggactgctggctccttgctgcaattggctccctgacgctcaat
gaggatttgctgcacagggtggttccgcatgggcagggcttccaggatgactacgccggg
atcttccacttccagatctggcagtttggcgagtgggtggatgtggtgatagacgaccgt
ttgccggtgaaggacggggagttggtgtttgttcactcggccgagtgctcggagttctgg
agcgccctgctggagaaggcctacgccaagttgaacggttcctacgaggccctgtcgggg
ggcagcaccaccgagggattcgaggactttaccgggggagtcgcggaaatgtacgaattg
cgcaaagccccccggaacctggataagatcattaaacgggcgctggacagggggtcccta
ttggggtgctccatagacataacgagtgcctttgacatggaagccgttacatttaagaag
cttgtgaagggccacgcctactcggtcacggcactcagagaggttaattacatggggggg
gtggaaaagctgatccgcatccggaacccctgggggcaggtggaatggaccggcgcctgg
agtgataactcctcagaatggaatgaagtggacccttcagagcaggaggatctgcagtta
aagatggaggatggagagttctggatgtctttccaggaattcctgcgccagttttcccgg
ctggagatctgtaacctgacgccggacgcgctggacaaggacgggcagagcaagtggcac
agcaccctgtacgacgggacgtggcgccggggcagcaccgccgggggctgcaggaacaac
ccagccacattctggattaacccccagttcaaggtgaccctgctggaggaggacgatgac
cccgatgacaacgagttggcctgcagtttcctggtggcgctgatgcagaagaaccggcgg
aaggagcgcaaggtcggccaggacatgcacaccattggctttgctgtgtatgaggttccg
gatgagttccgggggtgccagaatgtgcatctgaagaaggatttcttcctgcgccaccag
tcctgcgcccgctccgaaaccttcattaacctgcgggaggtgagcacccagatccgcctg
ccccccggcgagtacatcatcgtgccctccaccttcgagccccacaaggaggcagatttt
gtcctgagaatattcactgagaaacattcagatatacaggagctggatgaggaggtatcg
gcagatcttcctgaggaggaggaactcacagaagacgatgtggacgattcgtttaaggcc
atgttccgccaactggcaggggaggacatggagatcagtgtgtttgagctgaagacgatc
ctgaacagagtggtggccaaacacaaagatctgaagacggacggtttcgggatggaggcc
tgcaggcagatggtcaatctgatggacaaagacggcagcggcaaactgggcgtggtcgag
tttcagatcctgtggaacaaaattcgccaatggctgacagctttccgacaacacgacctg
gacaagtcgggcaccatcagcgcctacgagctgcgcatcgccctggagggtacagggtac
aaactgaataacaaactcattcaggttctggtcgctcgctacgcggattccgacatggga
atcgacttcgataacttcgtctgctgcctcgtgaagctggaggccatgttccggttcttc
aaggcgttggaccaaggggagggcacagccgagatgagtttaggggagtggctgacgatg
accatgtgtggataa

DBGET integrated database retrieval system