KEGG   Xenopus tropicalis (western clawed frog): 541455Help
Entry
541455            CDS       T01011                                 

Gene name
capn1, canp, canpl1, mucanp, mucl
Definition
(RefSeq) calpain 1, (mu/I) large subunit
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    541455 (capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    541455 (capn1)
   04217 Necroptosis
    541455 (capn1)
   04218 Cellular senescence
    541455 (capn1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     541455 (capn1)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C2: calpain family
   541455 (capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
4
AA seq 713 aa AA seqDB search
MAEEVIVPVYASGISAQLQKQRDQELGVGKHENAVKFLGQDYDRILHECLQNRTLFKDDT
FPPSAYSLGFKELGPNSSKTYGVKWVRPSQLVSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTILHRVVPHGQSFQDNYAGVFHFQLWQFGEWVDVVIDDYLPVKDGKLVFVHS
ASGNEFWSALLEKAYAKANGCYEALSGGSTSEGFEDFTGGVTEWYEMKKAPKDLFSIIMK
AVERGSLMGCSIDITSATDMEAVTFKKLVKGHAYSVTGAKEINFRGRSQKLIRMRNPWGE
VEWTGAWSDNSSEWNSVDAADSQDLRIKMEDGEFWMAFEDFLREFSRLEICNLTPDALTA
RKYRKWNTTVFNGNWRKGSTAGGCRNFPATFWINPQFKIKLDEEDDDDDFGSEKGCTFLL
ALMQKDKRKERRFGKDMETIGFAVYEVPSQFHGQSGVHLKRDFFLQNASRARSEQFINLR
EVSTRHKLPPGEYIVVPSTFEPNVEGDFVVRFFSENKHGSVEMDDPLSADLPPEEVLSEA
EIDQGFKNLFKQLAGADNEISATELQSILNKIMSKHKDLRTSGFSLESCRSMVNLMDKDG
NGKLGLVEFNVLWNKIKNYLTVFRKFDMDKSGSMSAYEMRLAVESAGFKLTNSLHQLIIT
RYSEPDMAVNFDSFTCCLIRLETMFRFFQGMDTEKKGVIHFDIFKWLQMTMFA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaagtgattgtgcccgtttatgcctccgggatttcggcgcagctgcagaag
caacgtgaccaagagctgggtgttgggaaacacgaaaatgcagttaaatttctgggacaa
gattatgaccggattctccacgagtgcctgcaaaacaggaccctctttaaggacgacact
ttcccaccctctgcttactctctgggctttaaggagctcggcccaaactcatccaaaacc
tatggagtaaaatgggttcggccttcgcaactcgtctccaacccacagtttattgtcgat
ggtgccacaagaacagacatctgtcagggagccttgggtgactgttggctcctcgctgct
atcgcctccctcacattaaatgatacaatcctgcaccgtgtagtacctcatggccagagc
tttcaggataattacgctggtgtctttcattttcagctgtggcagtttggcgagtgggtc
gatgtggttatcgatgattacctccctgttaaagatggaaaacttgtgtttgtgcattcg
gcttccgggaatgaattctggagtgccttgctggagaaggcctatgccaaggccaatggt
tgctatgaggctctttctggaggcagcacatcagaaggttttgaggattttacaggaggt
gttactgagtggtatgagatgaagaaagcaccaaaagatttatttagcattatcatgaag
gctgtggagagaggttccctcatgggctgttccattgatatcaccagtgccactgatatg
gaagctgtaacattcaagaagcttgtaaaaggccatgcatactctgttactggagccaaa
gagatcaacttcaggggtcggagccaaaagctgattcgaatgagaaatccatggggtgag
gtggagtggacaggtgcttggagtgataattcatctgaatggaattctgtggatgcagca
gacagtcaagacttgagaataaaaatggaggatggagaattttggatggcttttgaggac
ttccttcgtgaattttctcgccttgagatctgtaacctcacacccgatgcactcactgcc
cgcaaataccgcaagtggaacacaaccgtctttaatgggaactggaggaaaggtagcaca
gctggcggatgcagaaatttccctgccacattctggattaacccacagttcaagataaaa
ttggatgaggaggatgatgatgatgacttcggctcagaaaaaggttgcacattcctgctt
gcacttatgcaaaaggacaaacgcaaagagaggcgctttgggaaagatatggagaccatt
ggatttgcagtctatgaggttccttctcagtttcatggacagtctggtgtgcacctaaag
cgggacttcttcttacaaaacgcctcccgtgctcgctccgagcagttcataaacctgcga
gaagtcagcacccgccacaaactgccccccggagaatacattgtggtcccttctaccttc
gaacctaatgtggaaggagactttgttgttcgattcttttctgaaaacaagcatggctct
gttgagatggatgatccattatctgctgacctacctcctgaggaagtactgagtgaggct
gaaatcgatcaagggttcaagaaccttttcaagcagctggctggtgctgataatgaaatc
agtgctacagagttacagtccattttaaataaaattatgtcaaaacataaagaccttcgc
acatcgggatttagtttggagtcgtgccgcagcatggtgaacctgatggataaagatggg
aatgggaaattgggactggtggagttcaatgttctgtggaataaaattaaaaattacttg
acagtattccgaaagtttgacatggataaatctggaagtatgagtgcctatgagatgcgt
ttagctgtggagtctgcaggtttcaagttaaccaacagtctgcatcagctcatcatcacc
agatactcagagcctgatatggctgtgaattttgatagcttcacatgctgtctcatcaga
ctggagactatgttccgttttttccagggtatggacacagagaagaaaggagtgattcat
tttgacatttttaaatggctccaaatgacaatgttcgcatag

DBGET integrated database retrieval system