KEGG   Xenopus tropicalis (western clawed frog): 548375Help
Entry
548375            CDS       T01011                                 

Gene name
alpi.1, alpi, iap
Definition
alkaline phosphatase, intestinal, gene 1
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xtr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 529 aa AA seqDB search
MGYLVCLGWLLLWVCTARTQYATIPAEESQPEFWNNKMISRINEALKLKPIQHRAKNLIL
FLGDGMGVPTVTATRILSGQMKRMLGEENELAMDKFPYTALSKTYNVDRQVPDSAGTATA
YNCGVKANYGTVGVTAAVKRSNCSNMKGNEVESVLKKAKAAGKSVGIVTTTRVQHASPSG
TYAHIPDRDWYSDANMPADAVNFGCKDIAQQLISNVDIDVILGGGRKYMTPVGTSDPEYP
ADKKQNGIRKDGRNLIDEWLRKNKGAQYVWNKEQLDKINVSTAKHVMGLFEPADMKYELN
RNITTDPSIVELTEIAIRLLQRNPNGFYLFVEGGRIDHGHHDGQAKQALTEGVMFDRAIK
IAGQLTNEMDTLTVVTADHSHVFTFGGYTYRGSSIFGLAPKKAFDNKSYTSILYGNGPGF
NLTGQGRPNVDSNISEEVGYLQQAAVPLDSETHGGEDVAIFSKGPMSHLFHGVQEQTYVA
HVMAYAACLPPYKDCPPQRNAAPTTKTSAALLLVPAVWLLISPMVGLIF
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgggataccttgtgtgtctgggctggttgcttctctgggtttgcaccgctaggacccaa
tatgccactattccagcggaagagagccagcctgaattttggaacaacaaaatgatatcc
aggattaatgaagccctaaagctaaagcccattcagcacagagctaaaaacctgatcctc
ttcttaggtgatgggatgggagttccaacagtcactgccaccaggatcttaagtgggcag
atgaagagaatgctgggagaagaaaatgagctggcaatggacaagttcccctacacggca
ctctctaagacatacaatgtggatcgccaagttcctgacagcgccggtactgcaactgct
tataattgtggagtgaaagccaactatggaacagtcggagtgactgctgctgtcaaacgt
tccaactgcagcaatatgaaaggcaatgaggttgaatcggttctcaagaaagcaaaggca
gcaggaaaatcggtaggaattgttactacaacacgagtccagcatgcttccccctctggc
acttacgctcacattcctgaccgggattggtatagtgatgctaacatgcccgcagacgct
gtgaattttgggtgtaaagatattgcccagcagctgatttcaaatgtggacatagatgtc
atccttggtggggggcggaagtatatgacaccagtgggaacttctgatcctgagtaccct
gcagataagaagcaaaatggcataagaaaagatggaaggaaccttatagatgaatggctt
cggaaaaacaagggggctcagtatgtgtggaataaagaacaactggataaaatcaatgtc
tccactgcaaaacatgtgatgggtttgtttgaaccagcagatatgaaatatgagttgaac
cgcaatattactacagacccatccattgtggagctaacagaaatagctatccgtctccta
cagaggaaccccaatggattttacctctttgttgaaggtggaagaatagaccatgggcat
catgatggacaagccaagcaggcactaaccgagggggtaatgtttgacagggctatcaaa
atagcaggccagctcaccaatgaaatggatactctaactgtggtgactgctgaccactcc
catgtcttcacctttgggggttatacttatagaggaagcagcatatttggtctggctcca
aagaaagcttttgacaacaagtcttacacatccattctttatggtaatgggcctgggttc
aacctaactggccaaggccgtcctaatgtggatagcaatataagtgaggaagttggctat
ttgcagcaggcagcagtgcctttggattctgaaacccatggcggggaagatgtggccata
ttctcaaaggggcctatgtcacatctatttcatggagtccaggagcagacatatgtagcc
catgtcatggcatatgcagcttgtttgcctccctacaaggactgccctccccagcgtaat
gctgctcccacaaccaaaacaagtgctgctctgcttctggtgcctgctgtctggttactc
atctctcccatggttggtttaatattttaa

DBGET integrated database retrieval system