KEGG   Xenopus tropicalis (western clawed frog): 548436Help
Entry
548436            CDS       T01011                                 

Gene name
cyp2d6, cyp2d2
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    548436 (cyp2d6)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     548436 (cyp2d6)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP2 family
   548436 (cyp2d6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 505 aa AA seqDB search
MSLLSQLCPFALGCNVFTLGIIFTLLLLLLDFMKRRKPCTDFPPSPPSWPFVGNLLQMDF
RDLHNSFKQLSKQYGDVMSLRVFWKPTVVLNGFEVIKEALIQKSEDTADRPPFNLYEILG
FVGNNKAVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVRDEAGYLCDAFQSEQGGP
FDPHVLINTAVSNVICSIIFGERFEYDDHKFLKLLCLIEESIKAESGPVPQIISSLPWSS
KVPGLARLFFQPRIHMLQYLQEIINEHKQTWDSGHTRDFIDAFMLEMKKAKGVKDSNFND
QNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMGDVLQ
MPYTNAVIHEIQRYADIIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKP
FQFYPEHFLDRDGKFVKREAFMAFSAGRRVCLGEQLARMELFLFFTSLLQRFSFQIPDGE
PCLREDPVFVFLQVPHDYKICAKVR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagccttctatcccagctgtgcccatttgccttggggtgtaatgtcttcacactgggc
atcatcttcacccttctgcttctgctgttggacttcatgaagcgcaggaaaccctgcaca
gacttccctcccagccctccctcctggccctttgtggggaacctgctgcagatggacttt
agggacctccacaacagctttaaacagctctctaaacagtatggggatgtgatgagcctg
cgggtgttctggaaacccacggtggtgcttaatggatttgaagtaataaaggaggctttg
atacagaagtcagaggacacagcagatcgtcccccattcaacttgtatgaaatccttggg
tttgtaggaaacaacaaagctgtggtgttggcaaattacggccaatcttggaaggaccta
agaagattcaccttgtctacactgagggattttgggatgggaaaaaaatccctggaggag
agagtgagagacgaagctgggtacctgtgtgatgccttccagtctgaacaaggtggtccc
tttgacccccatgttttaataaacacagcagtcagtaacgttatctgctctatcatattt
ggggaacgctttgaatatgatgatcacaagttcctgaagcttctatgtctaattgaagaa
agtataaaagcggaatccgggccagtgccccagattataagttcacttccctggtcatct
aaagttccgggcctagccaggctgtttttccaacctcggatacatatgcttcaatatcta
caagaaattatcaatgagcataagcaaacatgggattctgggcacacaagggattttatt
gatgccttcatgcttgagatgaaaaaagcaaaaggagttaaagacagtaattttaatgac
cagaatcttctgttaactacagcggacttattttcagctggctcagaaactacaaccaca
accctgagatggggcctgctgtttatgttgctgtacccagatgtgcaaagaaaggtgcaa
gaggaaattgaccaagtgattggaagaaccaggaagcctaccatgggagatgtattacag
atgccttataccaatgcagtcatccatgaaatccagcgttatgcagatataatccctctc
tctgtgccacatatggcatacagagacacacatatcaaaggctttttcatcccaaagggc
accgttattatgaccaacctgtcctctgtgcttaaagatgagaaagtctgggaaaagcct
ttccagttttatccggagcattttcttgatagggacggcaaatttgtgaaaagagaagca
ttcatggcattctctgcaggtcgccgtgtttgcctaggagagcagttggccaggatggaa
ctgttccttttcttcacgtctctcctgcagcgcttctcatttcagatccctgatggcgag
ccttgcctacgggaagatccagtgtttgtattcttgcaggtcccacatgattataaaatc
tgtgccaaggttagatag

DBGET integrated database retrieval system