KEGG   Xenopus tropicalis (western clawed frog): 548436Help
Entry
548436            CDS       T01011                                 

Gene name
cyp2d6, cyp2d2
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xtr00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 505 aa AA seqDB search
MSLLSQLCPFALGCNVFTLGIIFTLLLLLLDFMKRRKPCTDFPPSPPSWPFVGNLLQMDF
RDLHNSFKQLSKQYGDVMSLRVFWKPTVVLNGFEVIKEALIQKSEDTADRPPFNLYEILG
FVGNNKAVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVRDEAGYLCDAFQSEQGGP
FDPHVLINTAVSNVICSIIFGERFEYDDHKFLKLLCLIEESIKAESGPVPQIISSLPWSS
KVPGLARLFFQPRIHMLQYLQEIINEHKQTWDSGHTRDFIDAFMLEMKKAKGVKDSNFND
QNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMGDVLQ
MPYTNAVIHEIQRYADIIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKP
FQFYPEHFLDRDGKFVKREAFMAFSAGRRVCLGEQLARMELFLFFTSLLQRFSFQIPDGE
PCLREDPVFVFLQVPHDYKICAKVR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagccttctatcccagctgtgcccatttgccttggggtgtaatgtcttcacactgggc
atcatcttcacccttctgcttctgctgttggacttcatgaagcgcaggaaaccctgcaca
gacttccctcccagccctccctcctggccctttgtggggaacctgctgcagatggacttt
agggacctccacaacagctttaaacagctctctaaacagtatggggatgtgatgagcctg
cgggtgttctggaaacccacggtggtgcttaatggatttgaagtaataaaggaggctttg
atacagaagtcagaggacacagcagatcgtcccccattcaacttgtatgaaatccttggg
tttgtaggaaacaacaaagctgtggtgttggcaaattacggccaatcttggaaggaccta
agaagattcaccttgtctacactgagggattttgggatgggaaaaaaatccctggaggag
agagtgagagacgaagctgggtacctgtgtgatgccttccagtctgaacaaggtggtccc
tttgacccccatgttttaataaacacagcagtcagtaacgttatctgctctatcatattt
ggggaacgctttgaatatgatgatcacaagttcctgaagcttctatgtctaattgaagaa
agtataaaagcggaatccgggccagtgccccagattataagttcacttccctggtcatct
aaagttccgggcctagccaggctgtttttccaacctcggatacatatgcttcaatatcta
caagaaattatcaatgagcataagcaaacatgggattctgggcacacaagggattttatt
gatgccttcatgcttgagatgaaaaaagcaaaaggagttaaagacagtaattttaatgac
cagaatcttctgttaactacagcggacttattttcagctggctcagaaactacaaccaca
accctgagatggggcctgctgtttatgttgctgtacccagatgtgcaaagaaaggtgcaa
gaggaaattgaccaagtgattggaagaaccaggaagcctaccatgggagatgtattacag
atgccttataccaatgcagtcatccatgaaatccagcgttatgcagatataatccctctc
tctgtgccacatatggcatacagagacacacatatcaaaggctttttcatcccaaagggc
accgttattatgaccaacctgtcctctgtgcttaaagatgagaaagtctgggaaaagcct
ttccagttttatccggagcattttcttgatagggacggcaaatttgtgaaaagagaagca
ttcatggcattctctgcaggtcgccgtgtttgcctaggagagcagttggccaggatggaa
ctgttccttttcttcacgtctctcctgcagcgcttctcatttcagatccctgatggcgag
ccttgcctacgggaagatccagtgtttgtattcttgcaggtcccacatgattataaaatc
tgtgccaaggttagatag

DBGET integrated database retrieval system