KEGG   Xenopus tropicalis (western clawed frog): 548457Help
Entry
548457            CDS       T01011                                 

Gene name
gpx1, gshpx1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xtr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xtr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 195 aa AA seqDB search
MRLAMVSRTVYEFSARLLSAGENTALSQYKGRVLLIENVASLUGTTIRDYTQMSRLQSMY
GPRGLQVLAFPCNQFGHQENSGNQEILNILKHVRPGGGFEPNFPLFEKVDVNGEKEHPLF
TFLKGQLPYPSDDSISLMQDPKSIIWSPVRRNDIAWNFEKFLIARNGVPYKRYGRRFETF
NIQQDIEKLLDETCE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttagctatggtatcccgcacggtgtatgagttctctgctcggctcctctccgct
ggggagaacacggctctgtcccagtacaagggcagagtgcttctcatcgagaatgtggcg
tctctctgaggcacaaccatccgggattatacccagatgagccggctgcagagcatgtat
ggcccccgcgggctgcaggttctcgccttcccctgtaaccagttcggacaccaggagaac
agtggcaaccaagagattctgaacattctgaagcatgtccgtcctgggggtggcttcgaa
cccaacttccccttgtttgagaaggtcgacgtgaatggagaaaaggagcacccactcttt
actttcctgaaggggcaacttccgtatcctagcgatgactccatctccctcatgcaggat
cccaagagcatcatctggtcccctgtgcgtaggaatgacatcgcctggaacttcgagaag
ttcctgatcgctaggaatggggtcccgtacaagcgctacgggcgtcgattcgagacattc
aacatccagcaggacatcgagaaactgctggatgaaacttgtgaatag

DBGET integrated database retrieval system