KEGG   Xenopus tropicalis (western clawed frog): 548480Help
Entry
548480            CDS       T01011                                 

Gene name
cav2, Cav-2, cav, caveolin-2
Definition
caveolin 2
Orthology
K12958  
caveolin 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Endocytosis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    548480 (cav2)
  Cell communication
   04510 Focal adhesion
    548480 (cav2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 160 aa AA seqDB search
MGLEKEKADARIFMDEDELNHSTVPMLTEKTFDNSPDRDPHKLNSHLKIGFEDVIGEPDT
THSFDRVWVFSTALFEISKYLIYKVLSVLLAVPLAFVMGILFAVLSCLHIWIVMPFVKTC
MMMFPSVQIIWKGVTDSLIAPLFASMGRCLSSVNVQLDRD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcgaaaaggagaaggcagatgcccgcattttcatggatgaagatgaactgaat
cactccactgtcccgatgctgacagaaaaaacattcgacaacagccccgaccgtgacccc
cacaagctgaactcccacctgaagataggctttgaggatgtgatcggagagccagataca
actcacagctttgacagggtctgggtgttcagcacagctctgtttgagatcagcaaatac
ctgatctacaaggtcctgagtgttctgcttgccgtgccgctggcatttgtaatgggaata
ctgttcgcagtgctcagctgcctacacatttggattgtgatgccttttgtgaagacctgt
atgatgatgtttccttctgtacagataatatggaagggtgtgacagatagcttaattgct
cccttatttgcaagcatgggacgttgtctttctagtgttaatgttcagctggatcgggat
taa

DBGET integrated database retrieval system