KEGG   Xenopus tropicalis (western clawed frog): 548515Help
Entry
548515            CDS       T01011                                 

Gene name
gys2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00500  Starch and sucrose metabolism
xtr01100  Metabolic pathways
xtr04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    548515 (gys2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    548515 (gys2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     548515 (gys2)
Glycosyltransferases [BR:xtr01003]
 Polysaccharide
  Storage polysaccharide
   548515 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 548515
NCBI-ProteinID: NP_001015798
Xenbase: XB-GENE-6456620
UniProt: Q5FVV6
AA seq 703 aa AA seqDB search
MPLSRSLSVSSLNGLPQWQDEDLPLQDLLLFEVAWEVTNKVGGIYTVIQTKAKVTADEWG
DNYFLMGPYMEQNVRTQVEICDPPSPQIRKAIDLLQSQGCQVYFGRWLIEGNPYVVLFDI
GSAAWNLDRWKGEFWECCSVGIPYNDREANDALIFGSLTAWFLKELTDQFQDKPNLIAHF
HEWQAGAGLILCRNQKLPVATIFTTHATLLGRYLCAANEDFYNRLDQFDIDREAGDRQIY
HRYCMERAAVHCAHVFTTVSQITGIEAENMLKRKPDVITPNGLNIKKFSATHEFQNLHAM
YKAQIQEFVRGHFYGHLDFSLEKTLFFFIAGRYEYTNKGADIFLEALSRLNFLLRVHRSD
VTVVVFFIMPTKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLKGEIPDLNKI
LDRDDLTIMKRAIFATQRQSLPPVTTHNMVDDSADPILNTIRRIGLFNSRTDRVKVIVHP
EFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGVYITDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRFYTHARHLALSRMFPDKFHMEPSAPPKTEGFRYPRPSSVPPSPAVSQPSSPRDSEE
EDEDEERYDEDEEAERDRQNIKSDFSLGPVSRGKKKKHGEFRN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgagccgctccctgtctgtctcctctctcaacggcctcccccagtggcaggat
gaggatttgcccctgcaggacctgctgctcttcgaggtggcctgggaggtcaccaacaaa
gttggtggtatttacaccgtcattcagaccaaggccaaggtgacggcggacgagtggggg
gacaattacttcctgatgggcccctacatggagcagaacgtcaggacccaggtggagatt
tgcgacccgcccagcccccagatccgaaaagccatcgacctgctgcagtcacaggggtgt
caggtttatttcgggaggtggctgatagaggggaacccgtacgtggtgctgttcgacatc
ggttccgcggcctggaatttggaccggtggaaaggggaattctgggaatgctgcagcgtg
gggatcccctacaatgatcgagaggccaatgacgccctcatatttgggtctttgaccgcc
tggttcctaaaagagttgacagatcaatttcaagacaaacccaatctcattgcccatttc
cacgaatggcaagcgggggcggggctaatcctctgccgcaaccagaagctcccagtggcc
accatattcaccacccatgccaccctgctgggccggtacctctgtgctgctaatgaggat
ttctacaatcgactggaccagttcgatatagaccgggaggccggtgaccggcagatctat
caccgttactgcatggaacgcgccgcggttcattgcgctcacgtattcaccaccgtgtcg
cagatcaccgggatcgaggcggagaacatgctgaaacgaaaaccagacgtcatcaccccc
aatgggttaaatatcaaaaaattctcagcgacccacgaattccagaatctgcacgcgatg
tacaaagcccaaatccaggagtttgtgaggggccacttctatggacacctggatttcagt
ctggagaagacgctcttcttcttcatcgcggggcgctacgagtatacgaataagggggca
gacatattcctggaggcgctgtctcggctcaacttcctactcagggtacacaggagtgac
gtcacagtggtggtgtttttcatcatgccgacaaagacaaacaacttcaatgtggagacg
ttaaagggacaggcggtgaggaagcagctctgggatacggcccattcagtcaaggagaag
tttgggaagaagttgtacgatgcgctactcaaaggagaaattcccgatctcaataagatt
ctggaccgtgatgatctcaccattatgaaaagagccatttttgccacccagcgccagtct
cttcccccggtgacgacccataatatggtcgatgactccgcagacccaatactcaatacc
atacggcgcattgggctcttcaacagcagaacagacagagtaaaggtcatcgtgcaccca
gaattcctctcttccaccagccccctcctgcccatggactacgaggagttcgtacggggg
tgccacttgggggtgttcccttcttattatgagccctggggctatactccagccgaatgc
accgtgatgggaatcccaagcgtcaccaccaacctctccggctttggctgcttcatgcag
gaacatgtggccgacccggctgcctacggggtttatatcacggacaggaggttccgctcc
cccgatgagtcctgtaaccaactgacccagttcctgtacgggttctgccagcagtctcgg
cgccagaggatcatccagcggaaccggaccgagcgactgtcagacctgctggactggaga
tacctgggccggttctacacgcacgcccgacacctggcgctgagccgcatgttccccgac
aagttccacatggagcccagcgccccccccaagaccgaggggttccgataccccagacct
tcctccgtgcccccctctcccgctgtctcacagccctccagtccccgtgacagtgaagaa
gaggatgaggatgaggagagatacgatgaagatgaagaagcagaaagggaccggcagaac
atcaagtcggacttctctctggggccggtgtcacggggaaagaagaagaaacacggggaa
ttcagaaactga

DBGET integrated database retrieval system