KEGG   Xenopus tropicalis (western clawed frog): 548562Help
Entry
548562            CDS       T01011                                 

Gene name
gtf2h4, gtf2h4.2, tfb2, tfiih
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:xtr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:xtr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 455 aa AA seqDB search
MKLQRVQLKCKNLHEFLQELSPGVLDQLYNHPATCLAVFRELPGLAKNYVMRMLFLEQPL
PQAAVALWVKKENFKEHEENTQVLTGLRLWHTQQLPGGLQGLILNPIFRENLKIALLGGG
KPWADDGCLLGPDKHGKDVVSLDKYAEERWEVILHFMVGSPSAAVSQDLAQLLIQAGLMK
SESGEAPCISSAGFQFLLLDTPSQLWYFMLQYLKSAESRGMILVEILSFMFQLSFSTLGK
DYSVEGMSDSLLTFLQHLREFGLVFQRKRKSRRYYPTRLAINLASGISGSVVDSHKQGFI
VVETNYRIYAYTDSELQIALIALFSEMLYRFPNLVVAQVTRENVQQAIGNGITAEQIIHF
LRTRAHPVMLQQNPVLPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLRNYARD
LGVLVFENPAKRVMVVTPGGHSDVKRFWKRQKHSS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccagcgggtacagctgaagtgtaagaatttgcatgagtttcttcaggaactc
agcccaggggtgctcgatcaattgtacaaccatccagcaacatgtttggctgtgttcagg
gaactcccaggactggccaaaaattatgtgatgcgtatgctatttctggaacaacccttg
cctcaagctgcggttgcattatgggttaagaaggaaaatttcaaggagcatgaggagaat
acacaagtcctgactgggttacggctttggcacacacagcagcttcctggtgggctacag
ggtctgattctcaatccaatctttagagaaaatcttaaaatagctctgctaggcggggga
aaaccttgggcagatgatggttgcctactaggccctgataaacatggaaaagatgtggtc
tcgttggataagtatgcagaagagagatgggaggttattttacattttatggttgggtct
ccaagtgctgctgttagccaggacttggcacaactgcttatacaggccggccttatgaaa
agtgagtctggggaagccccctgtatttcatcagctggcttccaatttttgcttttggac
acaccttctcagctctggtattttatgcttcaatatctcaaatccgcagagtctcgtggg
atgattctggtggaaatactctccttcatgttccagttaagcttctcaacattgggaaag
gattactctgtggaagggatgagtgattccttacttacttttcttcaacacttgcgtgaa
ttcggccttgtgtttcaaagaaagagaaagtcccgccgttactatccaacacgtctggct
ataaacctcgcatctggaatatctggatcagttgttgacagccataagcaagggtttatt
gttgtggaaacaaactacagaatatatgcatacacagattcagagctgcagattgctctg
attgccctgttttctgaaatgctgtatcgtttcccaaacctggttgtggcacaggtcact
cgagagaatgtacagcaagctataggaaatggcatcaccgctgagcagataattcatttt
ctgaggacaagagcacatccagtgatgttgcagcagaacccagtgcttccaccaacaatt
actgaccaaattcgactgtgggaactggagagagaccgtctacgtttctctgaaggtgtc
ctgtacaaccagtttttatcccaagtggactttgaacttttgagaaattatgcacgagac
cttggagtgttggtgtttgagaatccagccaagcgtgtgatggtggtgacacctggagga
cattctgatgttaagcgcttctggaaacgccaaaagcacagctcctaa

DBGET integrated database retrieval system