KEGG   Xenopus tropicalis (western clawed frog): 548663Help
Entry
548663            CDS       T01011                                 

Gene name
eif4e, cbp, eIF-4E, eif4e1, eif4el1, eif4f
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03013  RNA transport
xtr04150  mTOR signaling pathway
xtr04910  Insulin signaling pathway
Module
xtr_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    548663 (eif4e)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    548663 (eif4e)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    548663 (eif4e)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     548663 (eif4e)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     548663 (eif4e)
Translation factors [BR:xtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    548663 (eif4e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 548663
NCBI-ProteinID: NP_001015909
Xenbase: XB-GENE-855435
UniProt: Q28CE6
Position
1
AA seq 214 aa AA seqDB search
MASVEPEGTNPQSTEEEKTETSQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLI
SKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRR
NDLDRFWLETLMCLIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVY
KERLGLPAKVVIGYQSHADTATKSGSTTKNRFVV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgtggagccggagggtaccaatccccaatctacggaagaggaaaaaacagag
actagtcaggagattgtaagccccgatcagtacattaagcatccactacagaacagatgg
gccctttggttcttcaaaaatgacaaaagcaaaacttggcaggctaaccttcgcctaatt
tcaaaatttgatacagttgaagatttttgggcgctttacaatcatatccagttgtctagt
aatttaatgtcaggatgcgactactcgctctttaaggatgggattgagcctatgtgggaa
gatgaaaagaataagcgtggaggtagatggctaatcacactaaacaaacagcagagaaga
aatgatttagatcgcttttggctagagacgcttatgtgccttattggagagtcctttgat
gaatatagcgacgatgtatgtggagcagttgtaaatgttagagcaaaaggggataaaata
gcaatctggactactgaatttgaaaacagggacgctgttacacatatagggaaggtttac
aaagaaagattaggacttcctgcaaaggtagtgattggttatcagtcccatgcagacaca
gctactaagagcggctccaccactaaaaatagatttgttgtttaa

DBGET integrated database retrieval system