KEGG   Xenopus tropicalis (western clawed frog): 548664Help
Entry
548664            CDS       T01011                                 

Gene name
hexdc
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    548664 (hexdc)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     548664 (hexdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 379 aa AA seqDB search
MEFVLKHKEFAHLREVEAFPNTLNPHKEQSLPLVQAMIGQVMELHPDARWLHVGSDEVYC
LGEGNESKEIMANTQITVEEIFLHHLKSVTSHVASTFPGVRPIAWDDMIRAANEQALTES
GVAPLVELMLWDYSPDLDVDNKVATVAKYKQSGFQKIWFASAFKGATGVREQLTSINHHL
GNNSQWLKVAGKIPKELLQGIALTGWQRYDHFSVLCELLPVALPSVAVCLQFLKHGEYSD
QVMEQVKSFLGMTELENLASKCSGSFPGSKVFSLITQLMCNLRPELNELLGENRYVAGWF
SPYHRRINVISPLMVQEIQPATTSLMSRWQTLHDELQNELLQIYPPSAVAEWMEVNVLPW
YLQLKKLAEELNAALQNPL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgtgctgaaacacaaggagttcgctcacctgagggaggtcgaggcctttcca
aacaccctgaacccacacaaagaacaatctctgcctctggttcaagccatgattggccaa
gtaatggagttacatcctgatgcccgctggctccacgttggctcagatgaggtgtattgc
ctcggagagggcaatgagtccaaggaaatcatggccaatacccaaatcacagtcgaggaa
atctttttacaccatttaaagtctgtgacatcacacgttgcctccactttcccaggggtc
cgaccaattgcgtgggacgacatgattcgtgccgccaacgaacaggcgctgacagagtca
ggggtggcgcctctggtggaactgatgttatgggactacagtccagacctggatgttgac
aataaagttgctacggtggctaaatacaagcagagcggtttccagaagatatggttcgcc
agcgctttcaaaggggccaccggagtgagggaacagctcaccagtatcaaccatcatctg
ggaaacaacagccagtggctaaaagtggcagggaagataccgaaggagctgctacaggga
atagcgctaacgggctggcagaggtacgaccatttctcagtgctgtgtgagctgctgcct
gtggctcttccttctgtggctgtttgtctgcagttcctcaagcatggtgaatattccgac
caggtgatggagcaagtcaaaagcttcttgggaatgacagaactggaaaatttagcaagc
aagtgcagcggctcgttcccaggcagcaaagtcttctcccttattactcagctcatgtgt
aacctaaggccggaactgaatgagttactgggagagaacaggtatgttgccggctggttt
agcccgtaccacaggaggataaatgtcattagccctttgatggtgcaggagatccaacca
gccaccacgagcctgatgtcccgctggcagaccctccatgatgaactgcaaaatgagctg
ctgcagatctacccccccagcgccgtagcggaatggatggaggtgaatgtcctgccctgg
tacctgcagcttaagaagttggctgaagagctaaatgctgcgctgcagaacccgctctag

DBGET integrated database retrieval system