KEGG   Xenopus tropicalis (western clawed frog): 548664Help
Entry
548664            CDS       T01011                                 

Gene name
hexdc
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xtr00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 379 aa AA seqDB search
MEFVLKHKEFAHLREVEAFPNTLNPHKEQSLPLVQAMIGQVMELHPDARWLHVGSDEVYC
LGEGNESKEIMANTQITVEEIFLHHLKSVTSHVASTFPGVRPIAWDDMIRAANEQALTES
GVAPLVELMLWDYSPDLDVDNKVATVAKYKQSGFQKIWFASAFKGATGVREQLTSINHHL
GNNSQWLKVAGKIPKELLQGIALTGWQRYDHFSVLCELLPVALPSVAVCLQFLKHGEYSD
QVMEQVKSFLGMTELENLASKCSGSFPGSKVFSLITQLMCNLRPELNELLGENRYVAGWF
SPYHRRINVISPLMVQEIQPATTSLMSRWQTLHDELQNELLQIYPPSAVAEWMEVNVLPW
YLQLKKLAEELNAALQNPL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgtgctgaaacacaaggagttcgctcacctgagggaggtcgaggcctttcca
aacaccctgaacccacacaaagaacaatctctgcctctggttcaagccatgattggccaa
gtaatggagttacatcctgatgcccgctggctccacgttggctcagatgaggtgtattgc
ctcggagagggcaatgagtccaaggaaatcatggccaatacccaaatcacagtcgaggaa
atctttttacaccatttaaagtctgtgacatcacacgttgcctccactttcccaggggtc
cgaccaattgcgtgggacgacatgattcgtgccgccaacgaacaggcgctgacagagtca
ggggtggcgcctctggtggaactgatgttatgggactacagtccagacctggatgttgac
aataaagttgctacggtggctaaatacaagcagagcggtttccagaagatatggttcgcc
agcgctttcaaaggggccaccggagtgagggaacagctcaccagtatcaaccatcatctg
ggaaacaacagccagtggctaaaagtggcagggaagataccgaaggagctgctacaggga
atagcgctaacgggctggcagaggtacgaccatttctcagtgctgtgtgagctgctgcct
gtggctcttccttctgtggctgtttgtctgcagttcctcaagcatggtgaatattccgac
caggtgatggagcaagtcaaaagcttcttgggaatgacagaactggaaaatttagcaagc
aagtgcagcggctcgttcccaggcagcaaagtcttctcccttattactcagctcatgtgt
aacctaaggccggaactgaatgagttactgggagagaacaggtatgttgccggctggttt
agcccgtaccacaggaggataaatgtcattagccctttgatggtgcaggagatccaacca
gccaccacgagcctgatgtcccgctggcagaccctccatgatgaactgcaaaatgagctg
ctgcagatctacccccccagcgccgtagcggaatggatggaggtgaatgtcctgccctgg
tacctgcagcttaagaagttggctgaagagctaaatgctgcgctgcagaacccgctctag

DBGET integrated database retrieval system