KEGG   Xenopus tropicalis (western clawed frog): 548673Help
Entry
548673            CDS       T01011                                 

Gene name
kat7, hbo1, hboa, myst2
Definition
K(lysine) acetyltransferase 7 (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     548673 (kat7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 535 aa AA seqDB search
MEHTDSSESDGNSRGPARVTRSTARLSQSSQDPKNAGYHDESPPRTPTGNAPSSESDIDI
SSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHER
HFSISGCPLYHNLSADECKNCDEFQVRAQSRDKQVEDRMLSHRQDENNRHATRHQAPTER
QLRYKEKVTELRKKRNSGLTKEQKEKYMEHRQTYGDTREPLLENLTSEYDLELFRRAQAR
ASDDLEKLRLQGQITEGSNMIKTIIFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMK
SQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYY
DVEPFLFYVMTEGDNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYL
LSKVEDKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIV
STLQALQMLKYWKGKHLVLKRQDLIDEWASKDAKRTNSNKTMDPSCLKWTPPKGT
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacagacagctcagagagtgatgggaactcccggggtccagctagagtcact
cgatccactgcaagactgagtcagagctctcaggaccctaaaaacgcagggtatcacgac
gagtcaccgcctcgcactccaactggaaatgcaccgtcttctgagtctgacattgatatt
tccagccccaacgtgtctcacgatgagagtattgccaaggacatgtccctcaaggactct
ggaagtgacctttctcacaggcctaaacgaaggcgctttcatgagagctacaactttaac
atgaagtgccccactcctggctgcaactcattgggccacctgactgggaaacatgaaagg
catttctccatttctgggtgccctctgtaccacaacctctcggcagacgagtgcaagaat
tgtgatgaatttcaggtaagagcacagagccgtgataagcaagtggaggaccggatgcta
tcacatagacaggatgaaaataacaggcatgccacaagacaccaggctccgacagaacgt
cagttgcggtacaaagaaaaggtcaccgagctgagaaaaaaacgtaactctggcttgact
aaggagcagaaagagaagtacatggagcacaggcagacctatggagacacgagggaacct
ctcttagaaaacttgaccagcgagtatgacctggagctgtttcgaagggctcaagccaga
gcgtcagatgaccttgagaagctaagacttcagggccagatcacagaaggaagcaacatg
attaaaacaataatctttggtcgatatgaactagatacgtggtatcattctccttaccct
gaggagtatgcccgcctggggcgactgtatatgtgtgaattctgtctcaagtatatgaag
agccagacgatccttcgcagacacatggctaaatgtgtttggaagcatccaccaggggat
gagatttatcgtaaaggctccatctccgtctttgaagtagacggaaaaaagaataagata
tattgccagaatctgtgccttcttgcaaaacttttcctggaccataaaacactatactac
gatgtggaaccattcctcttctatgtcatgaccgagggagacaacactggctgtcacctt
attggctacttttccaaggagaagaactccttcctcaactacaatgtgtcttgtatcctg
acaatgccacagtacatgagacagggttatggcaagatgctgatagactttagttacttg
ctgtctaaggtggaagacaaagtgggttcaccggagcggcctctctctgaccttggtctc
atcagctaccgcagctactggaaagaagttctgctccgctacttgcacaattttcaaggc
aaagagatttccatcaaagagataagccaggagaccgcagtgaatccagtggatatagtt
agcaccttgcaggccctacagatgctcaagtactggaaggggaaacacttggtgttaaag
agacaggatctgattgatgaatgggcatccaaagacgcaaagagaaccaacagcaataaa
acaatggaccctagctgtctaaaatggacacctcctaaaggaacttaa

DBGET integrated database retrieval system