KEGG   Xenopus tropicalis (western clawed frog): 548830Help
Entry
548830            CDS       T01011                                 

Gene name
eif4e2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    548830 (eif4e2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    548830 (eif4e2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    548830 (eif4e2)
Translation factors [BR:xtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    548830 (eif4e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 212 aa AA seqDB search
MGLSGQEDLTTAEDDFTKSQKVKEVMVPPGEHPLQYKYTFWYSRRTPSRPASTHNYEQNI
RQFGTVASVEQFWRIYSHIVRPGDLTGYSDFHLFKDGIKPMWEDEANKNGGKWIIRLRKG
LASRFWENIILAMLGEQFMVGEEICGVVVSIRFQEDILSIWNKTANDQFSTVRIRDTLRR
VLNLPPNTIMEYKTHTDSLKDNSSFRNTKITV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtctggacaggaagacctcacaaccgcagaagatgacttcaccaaatctcag
aaggtcaaggaggtgatggtgcccccgggggaacacccgctccagtacaaatacaccttc
tggtactctaggagaaccccatccagacctgcaagtacccacaactatgaacagaatatc
cgccagtttggcaccgtagcgtcggtggagcagttctggagaatctacagccacatagta
cgtcctggtgatctgacaggctacagtgacttccatctctttaaggacggcatcaaaccc
atgtgggaggacgaagccaataaaaatggcgggaagtggatcattcgccttcggaaaggc
ctggcttccagattctgggagaacatcatcttggccatgttaggggagcagtttatggtc
ggggaagagatctgcggggtggtcgtatcaatccgcttccaggaggatatcctgtctatc
tggaacaagacggccaatgaccagttcagcaccgtgagaatccgggacacactaaggaga
gtgttaaatctgccccccaataccataatggaatacaaaacccacactgacagccttaag
gataactccagcttccgtaacacaaagatcacggtatag

DBGET integrated database retrieval system