KEGG   Xenopus tropicalis (western clawed frog): 548852Help
Entry
548852            CDS       T01011                                 

Gene name
pfn2, Profilin2, XProfilin2, d3s1319e, pfl
Definition
profilin 2
Orthology
K05759  
profilin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xtr04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xtr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 140 aa AA seqDB search
MSGWQDYVDMLMADGSCQEAAIVGYVDAKYVWATTPGGIFQIITPAEIDVLIGKDREGFF
TGGLTVGGKKCSVIRDSLYIDNDFTMDIRTKSQGGEPTYNIAVGKAVRVLVFAMGKEGVH
GGGLNKKTFAMAKYLRDMGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctggcaggattacgtggatatgctgatggccgatggcagctgccaggaggcc
gccattgtcggttacgtggacgccaagtacgtctgggcaacgactccggggggcatcttt
cagattataacgcctgcagaaattgatgtgctcatagggaaggacagagaaggattcttt
actggtggcctaactgtgggaggaaagaaatgctctgttataagagacagcctctatatt
gataacgatttcacaatggacatcagaacaaagagtcaaggaggagaaccaacatacaat
attgctgtaggaaaagccgtaagagtcttggtttttgcaatgggcaaggaaggcgtccac
ggaggcggcttgaataaaaagacattcgcaatggcaaaatacttgagagatatgggattc
taa

DBGET integrated database retrieval system