KEGG   Xenopus tropicalis (western clawed frog): 548942Help
Entry
548942            CDS       T01011                                 

Gene name
hibch
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    548942 (hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    548942 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    548942 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    548942 (hibch)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     548942 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 385 aa AA seqDB search
MSLGLLESQLRLKVFGRLQVIRQHLRMTNHTVKDGECLLTKAGCAGVITLNRPKALNALN
LGMIRLIYPQLGLWEEDPETYLVIIKGVGGKAFCAGGDIRAVTDAGKAGDRLAQDFFREE
YILNNAIGTYKKPYVALIDGITMGGGVGLSVHGHFRVASENTLFAMPETAIGLFPDVGGG
YFLPRLPGKLGLYLALTGFRLKGSDVQKAGIATHFVESEKIPSLEQDLVAMKCPSKENVA
DVLDSYHNKSYAAQDKPFVLAEHLDKINSLFSASSVEAIIENLRCDGSSFALKQLQTLST
MSPTSLKITFRQLKEGSSMSLQEVLTMEYRLSQACMKGYDFYEGVRAVLIDKNQNAKWNP
ELLEEVTDDYIDSYFTSLGNSDLKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaggacttctggaatcgcagttaaggctgaaggtctttggcagactgcaagta
attcggcaacatttgagaatgactaatcacacggtgaaagatggagagtgtctgcttaca
aaggctggatgtgcaggagtaattactttgaacagacctaaagcacttaatgcccttaac
ctcggtatgatcagactgatttatcctcagttagggctgtgggaagaagatcctgaaacc
tatctggtgattattaaaggagttgggggcaaagcattctgtgctggtggggacatcaga
gctgttacagatgcaggaaaagctggagacagacttgcgcaagattttttcagagaagaa
tatattctaaacaatgctattggtacttacaagaaaccttatgttgcattaattgatgga
ataacaatgggaggtggcgtgggtctgtcagtccatggacatttcagagtagcatctgag
aacactctctttgcaatgcctgagacagcaatagggctgtttccggatgttggaggaggg
tactttttgcctcgacttcctgggaagctcggcttgtatcttgcacttactggattccga
ttaaagggaagtgatgtacagaaggctggaattgcaacccactttgttgaatcggaaaag
attccatcccttgaacaagatcttgttgccatgaagtgcccttcgaaagagaacgttgct
gatgtgctggattcttatcataataagagttatgctgctcaggacaagccatttgtactt
gccgaacatttggacaagataaacagcttattctctgccagcagtgtagaagcaatcatt
gaaaatctgagatgtgatggctcttcttttgcattgaaacagcttcagacactttccact
atgtcgccaacatccttaaaaattacgttccggcagctcaaggaaggttcttccatgtca
ttacaagaggtacttactatggagtaccgacttagccaggcctgcatgaaaggatacgat
ttttatgaaggtgtaagggctgttttgattgacaaaaaccagaatgccaagtggaatcct
gagttattagaagaagtgacagatgattatatagatagctatttcacatcccttggaaac
agtgacctcaagctgtaa

DBGET integrated database retrieval system