KEGG   Xenopus tropicalis (western clawed frog): 548969Help
Entry
548969            CDS       T01011                                 

Gene name
impad1, impa3
Definition
inositol monophosphatase domain containing 1 (EC:3.1.3.25)
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:xtr00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xtr00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:xtr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 356 aa AA seqDB search
MAPMGIRLSPLGIGVFCLLGLGVLYHVYSGFLTGKFSAFLLGDRAEDPGPGEDTVDLREL
LAVSVRAAELGGLEVKKVRESNSLNEKAKGKTMEGADDKMTSGDVLSNKKMYHLIKNAFP
ALKVNTEEKVEADDEDAVSWDRNIPDDIKEQIKTKHVASESITMWIDPLDATQEYTENLV
NYVTTMVCVAVNGKPVIGVIHKPFTGFTAWAMLDGGSSIKKRNSYNEKTPTFIVSRSHSG
EVKEVTRQTFGNKTEIISAGGAGYKVLSLLDVTDDKQETADVYIHVTYIKKWDICAGNAI
LNALGGQMTTLKGEEIMYTGSELNKGGLLASIGMDHGVLVEKLAEKLQVNAKKPAK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcccctatgggtatccgtctctccccgctgggaatcggagtgttctgcttgctgggg
ctgggagtgctgtaccatgtatactcgggcttcctcaccggcaagttctcagccttcctc
ctgggggacagagcggaggatcccgggcccggggaggacacagtggatctgagggagctg
ctggctgtgtcggtgcgggctgcggagcttggggggctggaggtgaagaaggtccgggaa
agtaactcgctcaatgagaaggcgaagggcaaaaccatggagggggcggacgacaagatg
accagtggggatgtgctgtccaataagaaaatgtatcacctcatcaaaaatgccttcccg
gccctgaaggtgaacactgaggaaaaagttgaagcagatgatgaagatgcggtctcttgg
gatcgtaatattcctgatgatataaaggagcaaataaagacaaaacatgttgcatctgaa
agcattacaatgtggatagacccactagatgcaacacaggagtatacagaaaatctggta
aactatgtgactaccatggtatgtgtcgctgtaaatggcaaacctgttattggcgtaatc
cataaaccttttacaggttttactgcatgggccatgttggatggaggttcaagtataaag
aaacgaaattcatacaatgagaaaactcccacttttattgtgtcacgttctcattcggga
gaagtgaaagaggtcacccggcaaacatttggtaacaagacagaaatcatatcagcagga
ggagcaggttacaaggttctttcactgctggatgtgactgatgataagcaagaaactgct
gatgtgtatattcacgtcacctacattaagaagtgggacatttgtgctggcaatgcaatc
ctaaatgcacttggaggtcaaatgactactcttaaaggagaagaaattatgtacacagga
tcagaactgaataaaggggggctgctagccagcattggaatggaccacggtgtgcttgtt
gaaaaattagctgaaaaattacaagttaatgctaagaaaccagccaagtaa

DBGET integrated database retrieval system