KEGG   Xenopus tropicalis (western clawed frog): 548988Help
Entry
548988            CDS       T01011                                 

Gene name
kat8, mof, myst1
Definition
K(lysine) acetyltransferase 8 (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     548988 (kat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 465 aa AA seqDB search
MDSMSAEEQRNLTSPMNEQGTLASHDDGLDQLAIKEEEDEEAVSGGEIGTSGGVGRDQEV
TVEIGETYLCRRADNTWHSAEVIQSRLNEQEGREEYYVHYVGCNRRLDEWVDKNRLALTK
TVKDAVQKNTDQYLNELSEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAI
TKIKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWVCEYCLKYMKFEKSYRYHLGLCQWR
QPPGKEIYRKGNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDR
QGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENTVGSPEKPL
SDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIIGTLQSLNMVKYWKGQH
VICVTPKLVEEHLKSAQYKKPPITVDSINLKWAPPKHKLLKVTKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggattccatgtctgcagaggaacaaagaaacctaaccagccccatgaacgagcagggg
actctcgcctcacacgatgatggacttgaccaattggccattaaagaggaggaggacgag
gaggcggtgtctggaggagagattggcacttctggcggggtcgggagagatcaggaagtg
acggtggagattggggagacctacctgtgccggagagcagataacacttggcattctgca
gaggtgatccagtcgcggctaaacgaacaggagggtcgggaggagtactacgtgcattat
gtaggctgtaaccggcgactggacgaatgggtggacaagaacagactggcgctgaccaag
accgtgaaagatgccgtccagaagaacacagaccaatacctgaatgaactctctgagcag
ccggaaagaaagatcacccgaaatcagaagaggaaacacgatgagatcaaccacgtgcaa
aagacgtacgcagaaatggatccgaccaccgctgccctggagaaggagcatgaagcaatc
acgaaaatcaaatacgtggacaagattcacatagggaattacgagatcgacgcctggtac
ttctctccgtttcccgaggattatgggaagcagccgaagctgtgggtgtgtgaatactgc
ctgaaatacatgaagtttgagaagagctatcgataccacttgggtctctgtcagtggcgg
caacccccggggaaggagatttatagaaaaggcaatatctccgtgtatgaagtggatgga
aaagaccacaagatctattgtcagaacctctgcctccttgccaagctcttcctcgaccac
aagacattgtacttcgatgtggaaccctttgtgttttacattctgacagaggtggaccga
caaggagctcatatcgtgggatacttttccaaggagaaggagtcgccggatggaaataac
gtggcttgcatattgaccctccccccgtaccagaggcggggctatggaaagttcctcatt
gctttcagctatgaactctctaagctggagaacacggtgggttcccctgagaagccgctc
tctgacctgggcaagctcagctaccgcagttactggtcctgggttctgctggagatcctg
cgagatttccgcgggacgctctccatcaaggatctcagtcagatgaccagcattacccag
aatgacattatcggcaccttacagtccctgaatatggtgaaatactggaagggacagcat
gtcatctgcgtcacccccaaactggtggaggagcacctgaaaagcgcccagtataagaag
ccaccaatcacagtggactctatcaacttgaaatgggcccccccaaagcacaagctactg
aaggtcaccaagaagtga

DBGET integrated database retrieval system