KEGG   Xenopus tropicalis (western clawed frog): 549010Help
Entry
549010            CDS       T01011                                 

Gene name
ccnh, cak, p34, p37
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    549010 (ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    549010 (ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    549010 (ccnh)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     549010 (ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 323 aa AA seqDB search
MYHNSTQRKHWTFLNDDEPQRLRAQANARYRAKIQAAEKARVSEIFNLETHEELVICKYY
EKRLLDFCNAFKPTMPKSVLGTACMYLKRFYLNNSVMEHHPRIIMLTCVFLACKVDEFNV
SSVQFVGNLGENPLGQEKILEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
LENPEMLRKSADEFLNRVALTDACLLFAPSVIALTAILSTASRAGLNMESYLTECLSLKE
NQETMSHLYDGMRRLKILVSKYEPARSDEVAVLKKRLENCHSTEVTLSINARKRKGYEDD
GYISKKPKTEEEEWTDEDFTDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaacagcacccagagaaagcactggacctttctgaatgatgacgagccgcag
cgcctgcgggcccaggctaatgccaggtatcgggccaagatacaggctgcggagaaggct
cgtgtctctgaaatatttaatctggaaacgcatgaggaattggtcatttgcaaatactac
gagaagagattgttggatttctgcaacgctttcaaacccacaatgccaaaatctgttctg
ggaacagcctgcatgtatttgaaacgcttctacctcaacaattcagtcatggaacatcac
ccaagaataataatgttgacctgtgtgttcttggcttgtaaagtcgatgaatttaatgta
tccagtgtccagtttgtcggcaacctaggagaaaacccgcttggccaggagaagattcta
gaacagatcttagaatatgaactgttactgatacagcagctgaatttccaccttatagtg
cacaatccttacagaccttttgaagggtttctaatagatctaaagactcgatatccaatg
ctggagaatccagaaatgttgagaaaatctgccgatgagtttctcaatcgtgttgcattg
accgatgcatgtttgctgtttgccccatcagtaatagccctcacggctatcttatcaact
gcctcacgtgccggattaaacatggaaagttatttaacagaatgtctctcgctaaaagaa
aatcaagaaaccatgtcacatctatatgatggcatgagacggctcaagatacttgtgagc
aaatatgaacctgccagatctgatgaagttgcagttttaaagaagaggctggagaattgc
catagtactgaagtcactttaagtattaatgcacggaagagaaaaggctatgaagatgat
ggctatatatcaaagaaacctaaaacagaggaggaagagtggactgatgaagactttaca
gattctctatag

DBGET integrated database retrieval system