KEGG   Xenopus tropicalis (western clawed frog): 549042Help
Entry
549042            CDS       T01011                                 

Gene name
map2k5
Definition
mitogen-activated protein kinase kinase 5 (EC:2.7.12.2)
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Gap junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Cellular Processes; Cell communication; Gap junction [PATH:xtr04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 448 aa AA seqDB search
MLLFGFGLPLDMDSQALVIRIRIPDGGAVDWTVQPATQLLFRDILDVIGQVLPDATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYCTMVLEQQGSGPLTEPLQIYPRACKPPGKRNIHGL
KVNTRAGSSSNSSPSVPDNIAGNSLKKSSAELKKILANGQINELDIQCRDILGHGNGGTV
YKAYHVPSGKILAVKVIPLDITVELQRQIMSELEILYKCDSLYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEQVLGRIAVAVLKGLTYLWSLKILHRDVKPSNMLVNTRGHVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERIAGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNHGSLMPLQILQCIVDEECPVLPLGEFSESFVHFITQCMRKPPKERPAPEELMDHPFIV
QFNDGNTEAVSMWVCRALEERRMQSGQA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgttatttggcttcggcctgcctctggacatggatagccaggctctggttattcgg
atacgaatccctgatgggggcgccgttgactggacagtacagccggccactcagttgctg
ttccgggacatcttggatgtgattggtcaggttctcccagatgcaacaaccactgccttt
gagtatgaagatgaggatggtgatcggattacagttcggagtgatgaagaaatgaaggcc
atgttgtcatattattgcaccatggtccttgagcaacaggggagtggccctctgactgaa
cctctgcagatctatccacgtgcctgcaagcctcccgggaagcggaacatacatggcctc
aaggtgaacaccagagccggatcttccagtaacagcagtccgtctgtgccagacaatatt
gccggcaatagcttaaagaagtcctctgctgagctgaagaagattttggctaatggacag
attaatgagcttgatatccagtgccgtgacattctggggcatggaaatggagggaccgtg
tataaagcatatcatgtgccaagtgggaagattctggctgtaaaggtcatcccattagat
attactgtggagctgcagagacagattatgtcagagctggaaatcctgtacaagtgcgat
tctctgtacataattgggttttacggagcattttttgtggaaaaccggatttccatctgt
actgaatttatggatggtggatccctggatgtgtaccggaagattccagaacaggtcctt
ggaagaattgctgttgctgtattaaaaggcttgacttacctgtggagcttaaagatttta
cacagagatgtaaagccttctaacatgctggtgaacacacgtggccatgtgaagttgtgc
gactttggtgtgagcacacagttggtgaattctatcgccaagacgtatgtgggaacaaac
gcttatatggcgccagagcgtattgcaggagaacagtatggaatccactctgatgtctgg
agtttgggcatctcttttatggagttggcgcttggaagattcccttatccacagattcag
aaaaaccacggatctttaatgccgctccagatattgcaatgcattgttgatgaggagtgt
cccgtgctccctttgggtgaattctcagagtccttcgtacacttcattacacagtgtatg
agaaagccaccaaaggagagaccagcacctgaagagctaatggatcaccctttcattgtc
cagtttaatgatggcaacacagaagcagtgtccatgtgggtgtgccgggcactggaagag
cggaggatgcaaagtggacaggcgtga

DBGET integrated database retrieval system