KEGG   Xenopus tropicalis (western clawed frog): 549074Help
Entry
549074            CDS       T01011                                 

Gene name
dlat
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00020  Citrate cycle (TCA cycle)
xtr00620  Pyruvate metabolism
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
Module
xtr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    549074 (dlat)
   00020 Citrate cycle (TCA cycle)
    549074 (dlat)
   00620 Pyruvate metabolism
    549074 (dlat)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     549074 (dlat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 549074
NCBI-ProteinID: NP_001016320
Xenbase: XB-GENE-982534
UniProt: B1H2L3
Position
7
AA seq 628 aa AA seqDB search
MLRLCLRLRAPARSVLSGRSQAASTCRYRRLHLGPVNRLRGLVGSPANVPPVKGALRQGT
ASGRRWYSLPPHQKVPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFES
LEEGYMAKILVAEGTRDVPIGSVICITVDKPEFIDAFKNYTLDSTAATPPSVSAATPSPP
PPPAVQAPGSTYPNHMKICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIG
FEVPEEGYLAKILIEEGTRDVPLGTPLCIIVEKESDIGSFEDYKELTGVADIKPQPAAPT
PTAAPPPVPQVAVPPPAPTPSAAPSAPKGRVFISPLARKLASEKGIDIKQVKGSGPEGRI
TKKDIDSFVPPKAAPVPAAAPAPTVAVPSPAVAAVPSGVFTDVPISNIRRVIAQRLMQSK
QTIPHYYLSIDINMGEIVQLRKELNEVTKADNIKLSVNDFIIKASALACLKVPEANSSWL
DTVIRQHHVVDVSVAVSTPVGLITPIVFNAHTKGLATISKDVLSLATRAREGKLKPHEFQ
GGTFTVSNLGMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASMMFVTLSCD
HRVVDGAVGAQWLAEFKKFLEKPTTMLL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcctgtgcctgaggctccgcgccccggctcgctctgttttatccggtcggagc
caagctgcgtcgacatgtcggtaccgaaggcttcatttgggacccgtgaaccggctgaga
ggcttggtcgggtctccggcaaatgttccaccagtaaagggagctttgaggcagggaaca
gcctctggaaggagatggtacagcctacctccgcaccagaaggtgcctttgcctgccttg
tctcccaccatgcagatgggaaccatagctcgctgggaaaagaaagaaggtgataaaatt
aatgaaggggatctaattgctgaggttgaaacagacaaggccaccgtgggttttgagagt
ctggaggagggttatatggctaaaattcttgtggcagaaggaacaagggatgtgcccatt
ggctcagttatttgcattactgtggacaaaccagagtttattgacgcttttaaaaattac
acactggactccacggctgcaactccaccaagtgtgtcagctgctacaccatcaccacca
cctcctcctgcagttcaagccccgggtagcacttaccccaaccatatgaaaatctgtctg
cctgcactttctccaaccatgaccatgggtacagtgcaaaagtgggaaaagaaggttggt
gagaagctcagcgagggagaccttctggctgaaattgagacagacaaagctactatagga
tttgaagtgccagaagaaggttatttggctaaaattcttatcgaagaaggcacacgtgat
gtacctttgggcacccctctttgcattattgttgagaaagaatcagacatcggcagcttt
gaagattacaaagagttaactggagtagctgatatcaaacctcagcctgcagctcccacc
ccaactgcagctccaccacctgtcccacaagtagcagtgcctccccctgctcctacaccc
agcgctgctccctcagctcccaaaggaagggtgtttataagtccgcttgccagaaagctt
gcttctgaaaaaggaattgatataaagcaagtgaaaggaagtgggccagaaggaagaatt
acaaagaaagatattgactcatttgttcctcccaaagctgctccagttcctgctgcagcc
ccagcccctacagttgctgtaccatctccagctgtggctgctgttcccagtggagtcttc
acggatgtgcctattagtaatattcgcagggtaattgctcagcgactcatgcagtccaag
caaaccataccacactactatttatctattgatataaatatgggagaaatcgtacagctg
cgaaaagagctcaatgaggttaccaaggctgacaacattaaactatccgttaatgacttc
attattaaagcatcggctctggcatgtctgaaagtcccagaagcaaactcctcctggttg
gacactgtaattcgacaacatcatgtggttgatgtaagtgtggcagtaagcaccccagtt
ggtctgataactcctattgtgttcaatgcccataccaaagggctggcaaccattagcaaa
gatgtgctgtctctagctacccgggcacgagaaggcaagttgaaacctcatgaatttcaa
ggtggaaccttcactgtatccaacttgggaatgtatggaatcaaaaacttctccgcaata
attaacccaccccaggcctgcatcctcgctgtgggagggtcagaaaacagactgatacct
gcagacaatgaaaaaggctttgatgttgccagtatgatgtttgttacattaagctgcgat
caccgtgttgtggatggggcagtcggagcacagtggcttgcagaattcaaaaaattcttg
gagaaaccaacaacaatgctgctctaa

DBGET integrated database retrieval system