KEGG   Xenopus tropicalis (western clawed frog): 549074Help
Entry
549074            CDS       T01011                                 

Gene name
dlat
Definition
dihydrolipoamide S-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    549074 (dlat)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    549074 (dlat)
   00020 Citrate cycle (TCA cycle)
    549074 (dlat)
   00620 Pyruvate metabolism
    549074 (dlat)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     549074 (dlat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 628 aa AA seqDB search
MLRLCLRLRAPARSVLSGRSQAASTCRYRRLHLGPVNRLRGLVGSPANVPPVKGALRQGT
ASGRRWYSLPPHQKVPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFES
LEEGYMAKILVAEGTRDVPIGSVICITVDKPEFIDAFKNYTLDSTAATPPSVSAATPSPP
PPPAVQAPGSTYPNHMKICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIG
FEVPEEGYLAKILIEEGTRDVPLGTPLCIIVEKESDIGSFEDYKELTGVADIKPQPAAPT
PTAAPPPVPQVAVPPPAPTPSAAPSAPKGRVFISPLARKLASEKGIDIKQVKGSGPEGRI
TKKDIDSFVPPKAAPVPAAAPAPTVAVPSPAVAAVPSGVFTDVPISNIRRVIAQRLMQSK
QTIPHYYLSIDINMGEIVQLRKELNEVTKADNIKLSVNDFIIKASALACLKVPEANSSWL
DTVIRQHHVVDVSVAVSTPVGLITPIVFNAHTKGLATISKDVLSLATRAREGKLKPHEFQ
GGTFTVSNLGMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASMMFVTLSCD
HRVVDGAVGAQWLAEFKKFLEKPTTMLL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcctgtgcctgaggctccgcgccccggctcgctctgttttatccggtcggagc
caagctgcgtcgacatgtcggtaccgaaggcttcatttgggacccgtgaaccggctgaga
ggcttggtcgggtctccggcaaatgttccaccagtaaagggagctttgaggcagggaaca
gcctctggaaggagatggtacagcctacctccgcaccagaaggtgcctttgcctgccttg
tctcccaccatgcagatgggaaccatagctcgctgggaaaagaaagaaggtgataaaatt
aatgaaggggatctaattgctgaggttgaaacagacaaggccaccgtgggttttgagagt
ctggaggagggttatatggctaaaattcttgtggcagaaggaacaagggatgtgcccatt
ggctcagttatttgcattactgtggacaaaccagagtttattgacgcttttaaaaattac
acactggactccacggctgcaactccaccaagtgtgtcagctgctacaccatcaccacca
cctcctcctgcagttcaagccccgggtagcacttaccccaaccatatgaaaatctgtctg
cctgcactttctccaaccatgaccatgggtacagtgcaaaagtgggaaaagaaggttggt
gagaagctcagcgagggagaccttctggctgaaattgagacagacaaagctactatagga
tttgaagtgccagaagaaggttatttggctaaaattcttatcgaagaaggcacacgtgat
gtacctttgggcacccctctttgcattattgttgagaaagaatcagacatcggcagcttt
gaagattacaaagagttaactggagtagctgatatcaaacctcagcctgcagctcccacc
ccaactgcagctccaccacctgtcccacaagtagcagtgcctccccctgctcctacaccc
agcgctgctccctcagctcccaaaggaagggtgtttataagtccgcttgccagaaagctt
gcttctgaaaaaggaattgatataaagcaagtgaaaggaagtgggccagaaggaagaatt
acaaagaaagatattgactcatttgttcctcccaaagctgctccagttcctgctgcagcc
ccagcccctacagttgctgtaccatctccagctgtggctgctgttcccagtggagtcttc
acggatgtgcctattagtaatattcgcagggtaattgctcagcgactcatgcagtccaag
caaaccataccacactactatttatctattgatataaatatgggagaaatcgtacagctg
cgaaaagagctcaatgaggttaccaaggctgacaacattaaactatccgttaatgacttc
attattaaagcatcggctctggcatgtctgaaagtcccagaagcaaactcctcctggttg
gacactgtaattcgacaacatcatgtggttgatgtaagtgtggcagtaagcaccccagtt
ggtctgataactcctattgtgttcaatgcccataccaaagggctggcaaccattagcaaa
gatgtgctgtctctagctacccgggcacgagaaggcaagttgaaacctcatgaatttcaa
ggtggaaccttcactgtatccaacttgggaatgtatggaatcaaaaacttctccgcaata
attaacccaccccaggcctgcatcctcgctgtgggagggtcagaaaacagactgatacct
gcagacaatgaaaaaggctttgatgttgccagtatgatgtttgttacattaagctgcgat
caccgtgttgtggatggggcagtcggagcacagtggcttgcagaattcaaaaaattcttg
gagaaaccaacaacaatgctgctctaa

DBGET integrated database retrieval system