KEGG   Xenopus tropicalis (western clawed frog): 549111Help
Entry
549111            CDS       T01011                                 

Gene name
comt, mb-comt
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    549111 (comt)
  Amino acid metabolism
   00350 Tyrosine metabolism
    549111 (comt)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     549111 (comt)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   549111 (comt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 261 aa AA seqDB search
MVDVPTVVLSSAGTLCIAALFFTIYNRRRAHIKMALSLSYQAIKNILLCQTKEQRILDFV
LKNAVRGDPQSVIDNIDKYCSQREWSMNVGNEKGIILDNVVKESNPSTILELGTYCGYSA
VRICRLLKPGVRFFTVEFNPAYAAVAKQIIEFAGLIDKVQVLEGSTGDIIPQLKKKYEVD
TLDFVFVDHWKDKYKPDTQLLEKCNLLRKGSVVLADNVIVPGAPDFLEYVRNCGKYDCTN
FPSFLEYMDEKDALEKAVFRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatgtgcctacggttgtgttatcctcagcggggactctctgcattgcagccttg
ttcttcacaatttataatcggaggcgtgctcatattaagatggcattaagtctaagctat
caagccatcaaaaacatactgttatgccagaccaaggaacagagaattttagactttgtg
ctgaagaatgctgttcgtggggacccacagagtgtaatagataacattgacaaatactgc
agtcaaagggagtggtccatgaacgtgggaaacgaaaaaggtatcattttggataacgta
gtaaaagaaagtaacccatctacaatactggagctgggaacatactgtggatattctgct
gtccggatatgtcgcttactgaagcctggtgttcgcttcttcactgtggaattcaaccca
gcttatgccgcggtggccaagcagatcattgaatttgctggacttatcgacaaggtgcaa
gtactggaaggttccacaggtgacattatcccccaactaaagaaaaaatatgaagtggat
actctagattttgtctttgtagatcattggaaggataaatacaaaccagatactcagctc
ttggaaaaatgcaacttgctgagaaagggttcggtggttcttgccgacaatgtgatcgtg
ccaggggctcctgatttcctggaatatgtccggaattgtggcaaatatgactgtaccaat
ttcccatctttcttggagtatatggatgaaaaagatgccctagaaaaggctgtttttagg
ggataa

DBGET integrated database retrieval system