KEGG   Xenopus tropicalis (western clawed frog): 549157Help
Entry
549157            CDS       T01011                                 

Gene name
prkaca
Definition
(RefSeq) protein kinase, cAMP-dependent, alpha catalytic subunit
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04020  Calcium signaling pathway
xtr04114  Oocyte meiosis
xtr04140  Autophagy - animal
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04310  Wnt signaling pathway
xtr04340  Hedgehog signaling pathway
xtr04371  Apelin signaling pathway
xtr04530  Tight junction
xtr04540  Gap junction
xtr04910  Insulin signaling pathway
xtr04912  GnRH signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04916  Melanogenesis
Module
xtr_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    549157 (prkaca)
   04310 Wnt signaling pathway
    549157 (prkaca)
   04340 Hedgehog signaling pathway
    549157 (prkaca)
   04371 Apelin signaling pathway
    549157 (prkaca)
   04020 Calcium signaling pathway
    549157 (prkaca)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    549157 (prkaca)
  Cell growth and death
   04114 Oocyte meiosis
    549157 (prkaca)
  Cellular community - eukaryotes
   04530 Tight junction
    549157 (prkaca)
   04540 Gap junction
    549157 (prkaca)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    549157 (prkaca)
   04912 GnRH signaling pathway
    549157 (prkaca)
   04914 Progesterone-mediated oocyte maturation
    549157 (prkaca)
   04916 Melanogenesis
    549157 (prkaca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    549157 (prkaca)
   04270 Vascular smooth muscle contraction
    549157 (prkaca)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     549157 (prkaca)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: AGC group
  PKA family
   549157 (prkaca)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     549157 (prkaca)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    549157 (prkaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 549157
NCBI-ProteinID: NP_001016403
Xenbase: XB-GENE-5954970
UniProt: Q28GZ8
Position
3
AA seq 351 aa AA seqDB search
MGNAATAKKGGEIESVKEFLAKAKEDFLKKWENPAQNTAHLEQFERIKTLGTGSFGRVML
VRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMV
MEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFST
TDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSITEKCAKEFSDF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcggctaccgcaaagaagggcggcgagatagaaagtgtgaaagaatttctg
gcaaaagcaaaagaagattttctgaaaaaatgggaaaatccagcacagaacacagctcac
ctggaacagtttgagcgcattaaaactcttggcactgggtcattcgggcgagtaatgctg
gtcaggcacaaagaaaatggcagtcactttgctatgaagatcttggacaagcagaaggtg
gtgaagttgaagcagatcgagcacactttgaatgagaagcggatactgcaggctgtgaat
ttcccattcctcgtgcggctggagtattcctttaaggataacagcaatctgtatatggtc
atggagtatgtcgccggtggggagatgttctctcatttgcgcagaatcgggcgcttcagt
gaacctcatgcacgcttctatgcatcccagattgtattaacttttgaatatctgcacgcc
ctggatcttatatacagagacttgaaacccgagaatctcctcatagaccagcagggatac
atccaggtgacggattttggctttgcaaagagagtgaaagggaggacctggaccctgtgt
gggacaccagagtacctggcgccagaaataatccttagcaagggttataataaggcagtg
gattggtgggccctaggagtcctgatttatgagatggctgcggggtatcctccctttttc
gctgatcagcccattcagatctatgaaaaaatagtatcggggaaggtccggttcccctct
cactttagctccgacttgaaggatctcctcagaaaccttttgcaagtcgatctgactaag
cgatttgggaatttgaagaatggtgtgacagacatcaagggacacaaatggttcagtacc
acggactggattgcagtctaccagaaaaaggtggaagctcccttcatccctaaatgtaag
ggtcccggagacacaagtaattttgatgactatgaagaagaagagatccgagtttcaatc
acagagaagtgcgctaaggaattctctgacttctaa

DBGET integrated database retrieval system