KEGG   Xenopus tropicalis (western clawed frog): 549324Help
Entry
549324            CDS       T01011                                 

Gene name
aurka, Aurora-A, Eg2, aik, ark1, aur-a, aura, aurora2, btak, pEg2, stk15, stk6, stk7
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    549324 (aurka)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     549324 (aurka)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   549324 (aurka)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     549324 (aurka)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    549324 (aurka)
   Spindle formation proteins
    549324 (aurka)
  Sister chromatid separation proteins
   Aurora kinases
    549324 (aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 415 aa AA seqDB search
MERAVKENLPSNVKVFHPTMEGPKRIPVTQPPSTQVRPPGTAVSAQRILGPSNVPQRVVS
QAQKPVMSAQKPVMSTQKPMTQGPLRPVTHGHQAGKPQGPNENRTPQQTSHSSTPNVEKK
GSTDQGKTLAVPKEEGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKT
QLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILDYAPGGELFRELQKVTR
FDEQKSALYIKQLAEALLYCHSKNVIHRDIKPENLLLGANGELKIADFGWSVHAPSSRRT
TLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQ
YPSYVSEGARDLVSKLLKHNPNHRLSLKGVLEHPWIIDNSAQKPKRKEGPVTGAQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaacgggctgttaaagagaatcttccttctaatgtcaaggttttccaccccacaatg
gagggtcccaaacgtatcccagttacccagcctccgagcacccaggttagacctcctggg
actgccgtctctgcccagaggatattgggtccctccaatgtgccacagcgagtcgtgtct
caggctcagaaacctgttatgtccgctcagaaacctgttatgtccactcagaagccaatg
actcaggggccactgaggccagtaactcatgggcatcaggctggcaaaccacagggacca
aatgagaatcgtactccacagcagaccagccattcctccactccaaacgtggagaagaaa
ggaagcaccgatcaaggaaagactctggctgttcccaaagaggagggcaaaaagaaacag
tggtgcctggaagactttgagattgggcgccccctgggcaaagggaagtttgggaacgtg
tatctggcgcgcgagcgggagagtaaattcatcctggcgctgaaagtcctgtttaaaact
cagctggagaaggcaggggtagagcaccaactgcggagggaggtggaaattcagtcccat
ctcaggcatccaaacatcctccggctatatgggtacttccatgatgccgcccgagtctac
ctaatcctggattatgcccccggcggggagctgttccgagagctgcagaaagtcaccaga
tttgatgagcagaagagcgccttgtacatcaaacagctggcagaagccctcctgtactgt
cactccaagaacgtgatacaccgggatatcaagccagagaacttgctgctcggtgccaac
ggggaactgaagatcgctgactttggttggtctgtgcacgcgccgtcctccaggaggacc
actctgtgcggaaccctggactatctccctcctgagatgattgagggccgaatgcacgac
gagaaggtggacttgtggagcctgggagtcctctgttatgagttccttgtagggaaacct
ccatttgagactgacacccaccaggaaacctacagacgtatttcaaaggttgaatttcag
tatccttcgtatgtatcggaaggagccagagatctcgtatcgaagctgttaaagcacaac
ccaaaccacaggctgtccctgaagggggttctcgaacatccgtggatcatagataattct
gctcaaaagcccaagaggaaagaggggccggttacaggggctcaatag

DBGET integrated database retrieval system