KEGG   Xenopus tropicalis (western clawed frog): 549324Help
Entry
549324            CDS       T01011                                 

Gene name
aurka, Aurora-A, Eg2, aik, ark1, aur-a, aura, aurora2, btak, pEg2, stk15, stk6, stk7
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    549324 (aurka)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     549324 (aurka)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   549324 (aurka)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     549324 (aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 415 aa AA seqDB search
MERAVKENLPSNVKVFHPTMEGPKRIPVTQPPSTQVRPPGTAVSAQRILGPSNVPQRVVS
QAQKPVMSAQKPVMSTQKPMTQGPLRPVTHGHQAGKPQGPNENRTPQQTSHSSTPNVEKK
GSTDQGKTLAVPKEEGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKT
QLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILDYAPGGELFRELQKVTR
FDEQKSALYIKQLAEALLYCHSKNVIHRDIKPENLLLGANGELKIADFGWSVHAPSSRRT
TLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQ
YPSYVSEGARDLVSKLLKHNPNHRLSLKGVLEHPWIIDNSAQKPKRKEGPVTGAQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaacgggctgttaaagagaatcttccttctaatgtcaaggttttccaccccacaatg
gagggtcccaaacgtatcccagttacccagcctccgagcacccaggttagacctcctggg
actgccgtctctgcccagaggatattgggtccctccaatgtgccacagcgagtcgtgtct
caggctcagaaacctgttatgtccgctcagaaacctgttatgtccactcagaagccaatg
actcaggggccactgaggccagtaactcatgggcatcaggctggcaaaccacagggacca
aatgagaatcgtactccacagcagaccagccattcctccactccaaacgtggagaagaaa
ggaagcaccgatcaaggaaagactctggctgttcccaaagaggagggcaaaaagaaacag
tggtgcctggaagactttgagattgggcgccccctgggcaaagggaagtttgggaacgtg
tatctggcgcgcgagcgggagagtaaattcatcctggcgctgaaagtcctgtttaaaact
cagctggagaaggcaggggtagagcaccaactgcggagggaggtggaaattcagtcccat
ctcaggcatccaaacatcctccggctatatgggtacttccatgatgccgcccgagtctac
ctaatcctggattatgcccccggcggggagctgttccgagagctgcagaaagtcaccaga
tttgatgagcagaagagcgccttgtacatcaaacagctggcagaagccctcctgtactgt
cactccaagaacgtgatacaccgggatatcaagccagagaacttgctgctcggtgccaac
ggggaactgaagatcgctgactttggttggtctgtgcacgcgccgtcctccaggaggacc
actctgtgcggaaccctggactatctccctcctgagatgattgagggccgaatgcacgac
gagaaggtggacttgtggagcctgggagtcctctgttatgagttccttgtagggaaacct
ccatttgagactgacacccaccaggaaacctacagacgtatttcaaaggttgaatttcag
tatccttcgtatgtatcggaaggagccagagatctcgtatcgaagctgttaaagcacaac
ccaaaccacaggctgtccctgaagggggttctcgaacatccgtggatcatagataattct
gctcaaaagcccaagaggaaagaggggccggttacaggggctcaatag

DBGET integrated database retrieval system