KEGG   Xenopus tropicalis (western clawed frog): 549437Help
Entry
549437            CDS       T01011                                 

Gene name
abo
Definition
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    549437 (abo)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     549437 (abo)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     549437 (abo)
Glycosyltransferases [BR:xtr01003]
 Glycan extension
  ABO blood group
   549437 (abo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 287 aa AA seqDB search
MLYPKPETLKPPRTDVLTVSPWLAPIVWEGSFNTEILNNQFRQKGWRVGLTTFAIKKYIR
FLKPFIETAEKFFMVGLPVNYYVFTDQASNVTDLNIIVGTGRQIIILEVPSYERWQDVTM
RRMQMISDVCQQRFASEVDYLVCVDVDMRFQDHVGVEILSDVFGTLHPAFFVKGRDKFTY
ERRPESQAYIPEDEGDFYYAGGYFGGKVEEVYKLTNHCHHAMLTDKANNIEAIWHDESYL
NSYFLYNKKPTKILSPEYLWNEMDGTAFYLRKIRFIALQKNMAEVRT
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacccaaagccggagacccttaaacctccgaggactgacgtactgaccgtgtct
ccatggctggcccccattgtttgggaaggcagctttaacaccgaaatactaaataaccag
tttcgccaaaagggttggcgtgtcggcctcacaacgtttgcaattaaaaaatacataagg
tttctcaaaccattcattgaaacagctgagaagttcttcatggtgggactccctgtcaac
tactacgtcttcaccgatcaagcgagcaacgtaactgatttaaacataatcgttgggact
gggaggcaaattattatccttgaggtccccagttacgagcggtggcaggacgtcaccatg
agacgcatgcagatgattagtgacgtctgtcaacaacgctttgcctccgaggtggactac
ttggtgtgcgtggatgtggacatgagattccaagaccacgttggggttgagatcctcagt
gatgtgtttgggactttacacccggcgttctttgttaaagggagggacaaatttacttat
gaacgaaggccggagtctcaagcctacatccctgaagatgaaggagacttttattatgcg
ggaggttattttggaggaaaagtagaagaggtctacaagctgaccaaccactgccatcat
gctatgctcaccgacaaagcaaataacattgaagcgatctggcacgatgagagttacctg
aacagttactttctatataacaaaaagcctactaagatcctctctccggagtatctgtgg
aacgagatggatgggaccgcattctacctgagaaagataaggttcattgcacttcagaag
aatatggcagaagtccggacctaa

DBGET integrated database retrieval system