KEGG   Xenopus tropicalis (western clawed frog): 549478Help
Entry
549478            CDS       T01011                                 

Gene name
eif3b, eif3-eta, eif3-p110, eif3-p116, eif3s9, prt1
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    549478 (eif3b)
Translation factors [BR:xtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    549478 (eif3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 676 aa AA seqDB search
MEEEESTEEEEEEGMSFSDPEGFEDDISEEELLGDILKDRPQEADGIDSVVVVDNVPQVG
PDRLEKLKNVINKIFSKFGKITNEYYPEAEGTTRGYIFLEYALPTQAQDAVKNADCYKLD
KQHTFRVNLFTDFDKYMVIGDEWEAPEKQPFKDFGNLRSWLEDPDCRDQFSVIYESGDRT
SIFWTDVKEPVPVEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGV
QLIDFSPCERYLVTFSPLMDTKEEPQAIIIWDILTGQNKRGFHCESSAHWPIFKWSHDGK
FFARMTLDTLSIYETPSMGLLDKKSLKITGIKDFSWSPGGNIIAFWVPEDKDIPARVTLM
QLPSRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPV
DVVEMKDGIIAFAWEPNGSKFAVLHGEVPRISVSFYHVKNNGKIELIKMYDKQQANTIFW
SPQGQFLVLAGLRSMNGALAFVDTSDCTIMNIAEHYTASDVEWDPTGRYVVTSVSWWSHK
VDNAYWMWTFQGRLLQKNNKDRFCQLLWRPRPPSLLSQDQIKQIKKDLKKYSKIFEQKDR
LSQSKASKELIERRRAMMEEYKTYREMAAKLYMEQKAARLEIRGGVDTDELDSNVDDWEE
ETIEFFVTEEIIPVEE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaagagtccaccgaggaggaggaggaagaagggatgtcctttagcgatccg
gagggattcgaggacgatatcagtgaagaggagttgcttggtgatatcctgaaagaccgt
cctcaagaggcagatggaattgactctgtagttgtggtagataatgtgccacaggttgga
cctgaccgcttggaaaaactcaaaaatgtcatcaataaaattttctccaaatttggtaaa
attaccaatgaatattatccagaagcagaaggcaccaccaggggatacatttttctggag
tatgctttgccaactcaggcacaagatgcagtaaagaacgcagattgctacaaactggac
aagcaacacacattccgcgtgaatctcttcaccgactttgacaagtacatggttattgga
gatgagtgggaagcacctgaaaaacaaccatttaaagattttgggaatcttcgctcttgg
cttgaggatcctgactgccgagatcagttcagtgttatatatgaatcgggtgatcgtacc
tctatcttctggactgatgttaaggagccggtcccagttgaggagagagcaagatggact
gagacatatgtacgctggtctccaaaaggcacttaccttgccacctttcatcagagaggt
attgcactatggggtggagaaaagttcaagcaaattcagagattcagccaccagggtgtt
cagctcatcgacttttcaccgtgtgaaaggtatctggttacatttagccctcttatggac
actaaagaggaaccacaagccataatcatctgggacatactgacaggccagaacaaaaga
gggtttcactgtgagagctctgcacactggcctatattcaagtggagtcatgatggcaaa
ttctttgctcgaatgacattagatactcttagcatttatgaaacaccttccatgggcctt
ttggataaaaagagtttgaagattactggaataaaggacttctcctggtctcctggaggt
aacatcatagcattttgggtaccagaagacaaagacatccctgccagggtgactttaatg
cagctgccttcaagacaagaaatcagagttaggaatctgttcaatgttgttgactgcaag
ctgcactggcaaaagaatggtgattacctgtgcgtaaaggtcgaccgaacacctaaagga
acccagggagtggtgaccaattttgagatcttcagaatgcgagaaaagcaggttccagta
gatgtagtagaaatgaaagatggcatcattgcctttgcctgggaacctaatggaagcaag
tttgcagtgctgcatggtgaagtcccccggatatcagtttcattttaccatgtcaaaaac
aacggcaagattgagcttataaaaatgtatgacaaacagcaagctaacacaatcttttgg
agtcctcaagggcagttcttggtacttgctgggctaagaagcatgaatggcgctttagcc
tttgttgacacgtcagactgcactattatgaatatagctgaacactatacagcctctgat
gtggaatgggatccaactgggcgctatgttgtgacatctgtttcatggtggagccacaaa
gtggataacgcttactggatgtggacattccaaggccgcctccttcaaaagaacaacaag
gacagattttgccagcttctctggagaccaagacctccatcattgcttagccaagaccaa
ataaagcaaatcaagaaggatttgaagaagtattcaaagatatttgaacaaaaagatcgt
ttaagccaatctaaagcctcaaaggaactaatagagcgcagacgagccatgatggaagaa
tacaagacataccgggagatggcagcaaaactatacatggaacagaaagctgcccgtctg
gagatcagaggaggcgtggacacagatgagctggacagcaatgtggatgactgggaggaa
gagactatagagttctttgtaactgaagaaattatcccagtggaagagtag

DBGET integrated database retrieval system