KEGG   Xenopus tropicalis (western clawed frog): 549496Help
Entry
549496            CDS       T01011                                 

Gene name
cdk4, xcdk4
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
p53 signaling pathway
Tight junction
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    549496 (cdk4)
   04115 p53 signaling pathway
    549496 (cdk4)
  Cellular commiunity
   04530 Tight junction
    549496 (cdk4)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     549496 (cdk4)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   549496 (cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 319 aa AA seqDB search
MAKEMKGQYEPVAEIGVGAYGTVYKARDLQSGKFVALKNVRVQTNENGLPLSTVREVALL
KRLEHFDHPNIVKLMDVCASARTDRETKVTLVFEHVDQDLKTYLSKVPPPGLPLETIKDL
MKQFLRGLEFLHLNCIVHRDLKPENILVTSGGQVKLADFGLARIYSCQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFKRKPLFCGNSEADQLCKIFDMIGLPSEEEWPA
DVTLPRSAFSPRTQQPVEKFVPEIDAIGANLLLAMLTFSPQKRISASDALLHPFFAEDPQ
ACAKQEHFTHICTATDKVK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaatgaaggggcagtacgaacctgtggcagagatcggcgttggggcctac
ggcacggtatacaaggcccgagaccttcagagcggaaagtttgtggccctcaaaaatgtg
cgcgtgcaaaccaacgagaacgggctccccctctctacggtcagggaggtcgctttgctg
aagcgcctcgagcatttcgaccatccgaatattgtaaaactgatggacgtttgcgcttct
gcccgaactgaccgggaaactaaagtgacgctggtgtttgagcacgtggaccaggacctg
aagacttacctgagcaaagtcccgcccccaggtcttccactggagactattaaggacctc
atgaagcagttcctccggggcctggagttcctccatttgaattgcatcgtgcaccgagac
ctcaaacctgagaacatcttggtgacaagcgggggacaggtgaagcttgccgactttggc
ctggcgaggatatacagctgccagatggcactcacgccagtggtagtgacgttgtggtac
cgagccccggaagtcctgctccagtccacgtatgccacgccggtagatatgtggagtgtg
ggctgcatctttgcagagatgttcaagcgaaagcccctgttttgtggcaattccgaagcc
gaccaattgtgcaagatatttgatatgattgggcttccttctgaagaagagtggcccgcc
gacgtcactttgccacgttctgccttttccccaaggactcagcagccggtggagaagttt
gtgccggaaattgatgccataggagccaatctgctgctggccatgctgaccttcagtcct
cagaaacgcatctccgcctccgacgctctgctccaccccttttttgccgaggacccccag
gcctgcgccaaacaagaacactttacgcacatctgcaccgccacggacaaagtgaaatga

DBGET integrated database retrieval system