KEGG   Xenopus tropicalis (western clawed frog): 549496Help
Entry
549496            CDS       T01011                                 

Gene name
cdk4, xcdk4
Definition
(RefSeq) cyclin-dependent kinase 4 (EC:2.7.11.22)
  KO
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
p53 signaling pathway
Tight junction
AGE-RAGE signaling pathway in diabetic complications
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    549496 (cdk4)
   04115 p53 signaling pathway
    549496 (cdk4)
  Cellular commiunity
   04530 Tight junction
    549496 (cdk4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    549496 (cdk4)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     549496 (cdk4)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   549496 (cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 319 aa AA seqDB search
MAKEMKGQYEPVAEIGVGAYGTVYKARDLQSGKFVALKNVRVQTNENGLPLSTVREVALL
KRLEHFDHPNIVKLMDVCASARTDRETKVTLVFEHVDQDLKTYLSKVPPPGLPLETIKDL
MKQFLRGLEFLHLNCIVHRDLKPENILVTSGGQVKLADFGLARIYSCQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFKRKPLFCGNSEADQLCKIFDMIGLPSEEEWPA
DVTLPRSAFSPRTQQPVEKFVPEIDAIGANLLLAMLTFSPQKRISASDALLHPFFAEDPQ
ACAKQEHFTHICTATDKVK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaatgaaggggcagtacgaacctgtggcagagatcggcgttggggcctac
ggcacggtatacaaggcccgagaccttcagagcggaaagtttgtggccctcaaaaatgtg
cgcgtgcaaaccaacgagaacgggctccccctctctacggtcagggaggtcgctttgctg
aagcgcctcgagcatttcgaccatccgaatattgtaaaactgatggacgtttgcgcttct
gcccgaactgaccgggaaactaaagtgacgctggtgtttgagcacgtggaccaggacctg
aagacttacctgagcaaagtcccgcccccaggtcttccactggagactattaaggacctc
atgaagcagttcctccggggcctggagttcctccatttgaattgcatcgtgcaccgagac
ctcaaacctgagaacatcttggtgacaagcgggggacaggtgaagcttgccgactttggc
ctggcgaggatatacagctgccagatggcactcacgccagtggtagtgacgttgtggtac
cgagccccggaagtcctgctccagtccacgtatgccacgccggtagatatgtggagtgtg
ggctgcatctttgcagagatgttcaagcgaaagcccctgttttgtggcaattccgaagcc
gaccaattgtgcaagatatttgatatgattgggcttccttctgaagaagagtggcccgcc
gacgtcactttgccacgttctgccttttccccaaggactcagcagccggtggagaagttt
gtgccggaaattgatgccataggagccaatctgctgctggccatgctgaccttcagtcct
cagaaacgcatctccgcctccgacgctctgctccaccccttttttgccgaggacccccag
gcctgcgccaaacaagaacactttacgcacatctgcaccgccacggacaaagtgaaatga

DBGET integrated database retrieval system