KEGG   Xenopus tropicalis (western clawed frog): 549672Help
Entry
549672            CDS       T01011                                 

Gene name
sphk1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
  Lipid metabolism
   00600 Sphingolipid metabolism
    549672 (sphk1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    549672 (sphk1)
   04371 Apelin signaling pathway
    549672 (sphk1)
   04020 Calcium signaling pathway
    549672 (sphk1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     549672 (sphk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
10
AA seq 509 aa AA seqDB search
MGDTQDSPSGPSEVILCGTFTLVPGTGAPLSLILTRKELLIQTLSLDAQPSPHYSLALAD
CIGCRSFRGKDPTELGGYLTAAFCPLRGEALGKTIYRQRVSRTFRIEVSRDKEHNFNVAK
TWANRIWEMAEEQGPPSSILPPSRRFLVLLNPFAGTGKASGHFQTHVIPTLTEANATFTL
LETERPKQAQELVRDEDLSGWDAIVVMAGDGLLFEVVNGLMERPDWACAIKKPLAVLPGG
SGNALAASVSYYSGHKQASGTKLLNNCTFILCKGQPVPLDLVSLTTSSGRRIFSFLSFAW
GLISDVDIESERYRFMGSARFSFGTFVRLTALRTYRGRLSYLPARTSPDSTPESDSHRHN
LNSSTDTVNPNVLEDSLLVPLNEPVPPHWTTVTEDQFVLVLLLYQSHLGADLFTAPMVQS
PGEGVMQLFYATSRISRASLLKLFLGMEKGSHMGESIPHITNVPVTAFRLEPLENVGIMT
VDGESIPCCSLQGQIHKGLGRIISIPQGP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatacccaggattccccaagcggcccgtctgaggttatcctctgtggcactttc
acccttgtacctggcactggcgctccattgtcgctcatcctcactcgcaaggagcttttg
atacagaccctgtccctggatgctcagccgtctccccattactctctcgccctggccgac
tgcatcggatgccgctctttcagaggaaaagaccccacagaacttggggggtatcttact
gctgcattttgccccctcaggggtgaggcgctgggcaaaaccatttatcggcagcgagtt
tccaggacgtttagaatagaagtttcacgggacaaagagcacaactttaatgtggccaag
acctgggccaacagaatctgggaaatggctgaagagcaaggcccccccagcagcattctg
cctccctctcgccgattcctggttctgctgaatccattcgcagggactgggaaagcctca
ggccacttccaaacgcacgtgattcctacgttaacagaggccaatgccaccttcacgctc
ctagagacagagaggcccaagcaagcgcaggaactggtgagggacgaggacctgtccggc
tgggacgccattgttgtcatggcaggggacgggctgctgtttgaggtggtcaatgggctg
atggagaggccggactgggcctgtgccattaaaaagccgctggcagttctccctggtgga
tctgggaacgctctggctgcctctgtcagttactattctgggcacaaacaagcgtcgggc
accaagttgctgaacaattgcactttcattctatgcaagggacagcctgtacccctggac
cttgtatctcttaccacctcgtccggaaggcgcatcttctccttcctcagttttgcttgg
ggtttaatctctgacgtggacattgaaagtgagaggtacaggtttatgggttctgcccgt
ttctcatttggcacatttgtcaggctaacggcgctgcgtacctatagggggcgcctctcg
tacctcccagccaggacttcgccggactctacaccagagagtgactcgcacaggcacaac
ttaaacagttctacagacactgtaaaccccaatgtgttggaggactcattgctcgtccca
ttgaatgagccggttccacctcactggacaactgttacggaggaccagtttgtgcttgtc
ctgttgctctaccagtctcaccttggggctgacctcttcactgctcccatggtgcaaagc
ccgggagaaggggtcatgcagctgttctacgccacctctagaatctcccgggcatccctt
ctcaaactcttccttggcatggagaaagggtctcacatgggcgagtctatccctcacata
accaatgtccctgtcacagcctttcggctggaaccactcgagaacgttgggatcatgact
gtggatggagagtctataccatgttgttctctccagggtcagatccataagggcctgggg
cgcataatcagtatcccccagggaccatga

DBGET integrated database retrieval system