KEGG   Xenopus tropicalis (western clawed frog): 549675Help
Entry
549675            CDS       T01011                                 

Gene name
clk1
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     549675 (clk1)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   549675 (clk1)
Spliceosome [BR:xtr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    549675 (clk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 466 aa AA seqDB search
MHYSKRSRRPDEDEKEWYFSKCHKRKRSQSSDEEKERHKKISSSDSHYVEDKSMCSRGQH
DRRYVELRNNYKGGHHEHRHHYRSSKSSGQSSSSSSSHKKRHKKPHHSSRTSHLKSHRKK
RSRSVEVDEEGHLICESGDVLRERYEIVHALGEGAFGKVLECIDHLRGGERVAVKIIKNV
ERYREAAQSEIQVLEHLNRKDPINTFRCVQMLEWFDHHGHICIVFELLGLSTYDFIKENS
FLPFPLDHIRNMAYQICKSINFLHQNQLTHTDLKPENILFVHSDYVVHFNHAKKQDERYL
KNSDIKIVDFGSATYNDEYHSALVSTRHYRAPEVILELGWSQPCDVWSIGCILIEYYLGL
TVFQTHDSKEHLAMMERILGPLPLHMIKKTRKHKYFYLDRLDWDEHSSAGRYVKKRCKPL
KEYMVSDNKDHHQLFDLIQRMLEYDPAKRITLEEALKHPFFEVVQF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcactacagcaaacgaagtagacgtccagacgaggatgagaaggagtggtatttcagc
aagtgccacaaacgaaaaagatcacaaagcagcgatgaagaaaaggaacgccataaaaag
atctcatcatctgacagccactacgtggaggacaagtccatgtgttctagaggtcagcat
gacagacgatatgtagaactaagaaataactacaagggtggacatcatgaacatagacac
cactacagatccagcaagtcatctgggcaaagcagcagcagcagcagcagtcacaaaaag
agacataaaaagcctcaccattcaagccgcacttcacatttgaagagtcatcgaaagaaa
agatccagaagtgtagaggttgatgaggagggtcatctgatctgtgaaagtggagacgta
ctaagagaaagatatgaaattgtacatgctttgggagaaggagcttttggaaaagtattg
gaatgtattgatcatttaaggggtggtgagcgagtagcagtaaaaatcatcaaaaatgtg
gaaagatatcgggaagctgcacagtctgaaatacaagtattggagcatttgaacagaaaa
gatccaataaacacttttcgatgtgttcagatgctggagtggtttgatcaccatggccat
atttgcattgtttttgaacttcttggactaagtacttatgattttataaaagaaaatagc
ttcttaccttttcctttggatcacataagaaatatggcatatcagatatgtaaatctatt
aactttttacatcaaaaccaactgacccatacagatctgaaaccagaaaatatactgttt
gtccattctgattatgtagtccattttaatcatgcaaagaaacaagatgagcgctattta
aaaaatagcgatattaaaattgtagattttggaagtgctacatacaatgatgaatatcac
agtgctttggtttctacaagacactacagggctccagaagttatactggaattaggttgg
tcccagccttgtgatgtatggagcataggttgtattttaattgaatactaccttggatta
actgtgttccagactcatgacagcaaagaacatttagcaatgatggaacgaatactggga
cctttaccactccatatgattaagaaaactaggaaacacaagtatttttatcttgatcgg
ctggattgggatgaacatagttctgctggccgatatgttaagaagcgttgtaagccattg
aaggaatacatggtttctgataacaaggatcatcatcagctatttgatcttatccaaaga
atgttggagtacgaccccgctaaaagaataacgctggaagaagcattgaaacatccgttt
tttgaagtagtacaattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system