KEGG   Xenopus tropicalis (western clawed frog): 549675Help
Entry
549675            CDS       T01011                                 

Gene name
clk1
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 466 aa AA seqDB search
MHYSKRSRRPDEDEKEWYFSKCHKRKRSQSSDEEKERHKKISSSDSHYVEDKSMCSRGQH
DRRYVELRNNYKGGHHEHRHHYRSSKSSGQSSSSSSSHKKRHKKPHHSSRTSHLKSHRKK
RSRSVEVDEEGHLICESGDVLRERYEIVHALGEGAFGKVLECIDHLRGGERVAVKIIKNV
ERYREAAQSEIQVLEHLNRKDPINTFRCVQMLEWFDHHGHICIVFELLGLSTYDFIKENS
FLPFPLDHIRNMAYQICKSINFLHQNQLTHTDLKPENILFVHSDYVVHFNHAKKQDERYL
KNSDIKIVDFGSATYNDEYHSALVSTRHYRAPEVILELGWSQPCDVWSIGCILIEYYLGL
TVFQTHDSKEHLAMMERILGPLPLHMIKKTRKHKYFYLDRLDWDEHSSAGRYVKKRCKPL
KEYMVSDNKDHHQLFDLIQRMLEYDPAKRITLEEALKHPFFEVVQF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcactacagcaaacgaagtagacgtccagacgaggatgagaaggagtggtatttcagc
aagtgccacaaacgaaaaagatcacaaagcagcgatgaagaaaaggaacgccataaaaag
atctcatcatctgacagccactacgtggaggacaagtccatgtgttctagaggtcagcat
gacagacgatatgtagaactaagaaataactacaagggtggacatcatgaacatagacac
cactacagatccagcaagtcatctgggcaaagcagcagcagcagcagcagtcacaaaaag
agacataaaaagcctcaccattcaagccgcacttcacatttgaagagtcatcgaaagaaa
agatccagaagtgtagaggttgatgaggagggtcatctgatctgtgaaagtggagacgta
ctaagagaaagatatgaaattgtacatgctttgggagaaggagcttttggaaaagtattg
gaatgtattgatcatttaaggggtggtgagcgagtagcagtaaaaatcatcaaaaatgtg
gaaagatatcgggaagctgcacagtctgaaatacaagtattggagcatttgaacagaaaa
gatccaataaacacttttcgatgtgttcagatgctggagtggtttgatcaccatggccat
atttgcattgtttttgaacttcttggactaagtacttatgattttataaaagaaaatagc
ttcttaccttttcctttggatcacataagaaatatggcatatcagatatgtaaatctatt
aactttttacatcaaaaccaactgacccatacagatctgaaaccagaaaatatactgttt
gtccattctgattatgtagtccattttaatcatgcaaagaaacaagatgagcgctattta
aaaaatagcgatattaaaattgtagattttggaagtgctacatacaatgatgaatatcac
agtgctttggtttctacaagacactacagggctccagaagttatactggaattaggttgg
tcccagccttgtgatgtatggagcataggttgtattttaattgaatactaccttggatta
actgtgttccagactcatgacagcaaagaacatttagcaatgatggaacgaatactggga
cctttaccactccatatgattaagaaaactaggaaacacaagtatttttatcttgatcgg
ctggattgggatgaacatagttctgctggccgatatgttaagaagcgttgtaagccattg
aaggaatacatggtttctgataacaaggatcatcatcagctatttgatcttatccaaaga
atgttggagtacgaccccgctaaaagaataacgctggaagaagcattgaaacatccgttt
tttgaagtagtacaattttaa

DBGET integrated database retrieval system