KEGG   Xenopus tropicalis (western clawed frog): 549778Help
Entry
549778            CDS       T01011                                 

Gene name
galm
Definition
galactose mutarotase (aldose 1-epimerase) (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    549778 (galm)
   00052 Galactose metabolism
    549778 (galm)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     549778 (galm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 342 aa AA seqDB search
MTSVTRDVFGHLPGGGGTVERFCLDSKQVRAEVISFGCIITRLETQDRTGTFSDIVLGFD
DIEGYTNKHPYFGAVVGRVANRIANGKFTVEGKDYHLAINNGPNSLHGGLKGFDKVLWAP
KLIENGVQFSYQSKDGEEGYPGELNLWVTYTLVGGTLTVNYRAQSNKTTPINLTNHSYFN
LAGQGSSNIYDHVVSIEADHYLPVDDTMIPTGEVAPVLGTCFDLRKPVELGSHMNSFYLD
GFDHNFCLGVTQEQKQCARVSHPLSGRVLTVSTTQPGVQFYTANFLDGSLKGKGGAVYPK
HSAFCLETQGWPDAVNKPHFPSSLLNPEEEYNHTTSFGFSLA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtgacaagagatgtgtttggccacttgcccggtggtggaggaacagtggaa
agattctgccttgattctaaacaagtcagagctgaggtcatatcctttggctgcataata
actcgcttagaaacccaagacaggactggaacattctcagatatagttcttggttttgat
gatatagaaggctatacaaacaaacatccctattttggagcagttgttgggcgggtagca
aaccgaattgccaatggtaaattcactgttgaaggaaaggattatcatttggccataaac
aatggtccaaacagtctacacggaggccttaaagggtttgacaaagtgctatgggctcct
aagttgatagaaaatggtgtccagttctcctaccaaagtaaagacggtgaggaagggtac
cccggtgaattaaacttgtgggtaacgtacacacttgttggcggaacattgactgtgaac
tacagagcccaaagtaataagactactccaataaatctaacaaaccattcctacttcaac
ttggcaggacagggctctagtaatatctatgatcatgtggtttccattgaagctgatcat
tacctgcctgttgatgataccatgataccaacaggggaggtggcaccagttctgggaact
tgctttgatttaaggaaaccagtagagcttggcagtcatatgaactctttttatttagat
ggttttgaccacaatttttgcttgggtgttacacaggaacagaagcaatgcgcaagggtc
agccatcctctaagtggcagggtgcttactgtcagcacaactcagcctggggtccagttc
tacacagcaaatttcctggatggatctctcaagggcaaaggtggtgcagtgtatccaaag
cattcagcgttttgcttggaaacacagggctggccagatgcagtcaataagccacatttt
ccaagttctctgctgaatcctgaagaagaatacaaccacactacctcttttgggttttcc
cttgcttag

DBGET integrated database retrieval system