KEGG   Xenopus tropicalis (western clawed frog): 549834Help
Entry
549834            CDS       T01011                                 

Gene name
mapk12, Xp38gamma, erk3, erk6, p38gamma, prkm12, sapk-3, sapk3
Definition
mitogen-activated protein kinase 12 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    549834 (mapk12)
   04370 VEGF signaling pathway
    549834 (mapk12)
   04068 FoxO signaling pathway
    549834 (mapk12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    549834 (mapk12)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    549834 (mapk12)
   04621 NOD-like receptor signaling pathway
    549834 (mapk12)
   04622 RIG-I-like receptor signaling pathway
    549834 (mapk12)
  Endocrine system
   04912 GnRH signaling pathway
    549834 (mapk12)
   04914 Progesterone-mediated oocyte maturation
    549834 (mapk12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    549834 (mapk12)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    549834 (mapk12)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     549834 (mapk12)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   549834 (mapk12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 363 aa AA seqDB search
MSTSPLPKKGYYRQDVNKTVWEVKERYRDLVAVGSGAYGTVCSSLDTRTGTKVAIKKLYR
PFQSELFAKRAYRELRLLKHMQHENVIGLLDVFTPDSTLENFNDFYLVMPFMGTDLGKIM
KHEKLSEDRIQFLVYQILRGLKYIHSAGIIHRDLKPGNLAVNEDCELKILDFGLARHTDS
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMYTGRPLFKGNDHLDQLTEIMK
ITGTPTQDFVQKLQSPDAKNYIKSLPKVQKKDFGSLLRYANPLAVNILEKMLVLDAEKRI
TATEALAHPYFEQFHDIDDETEAEPYDDSFDNVNLPLEEWRRLTHKELTSYKPLVADSKE
TSV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctccccgttgcccaagaagggatactataggcaggacgtcaataagaccgtc
tgggaggtgaaggagaggtacagagacctggtggctgtgggatcaggagcctatggcact
gtttgctcatctctagacactagaactggaacaaaagtagctatcaagaaactgtaccgt
ccttttcaatctgaactctttgcaaagcgagcatatagagagctgaggcttttgaagcac
atgcagcatgaaaacgtaattggtctattggacgtgtttactccagactcaactttggaa
aatttcaatgatttttatttggtgatgccattcatgggtacggaccttggcaagataatg
aaacatgaaaagctatctgaagaccgaatccagttcctggtttatcagatcctcaggggg
ctaaagtacattcattcagctggaatcatccacagggatttaaagcctggaaatcttgca
gtaaatgaagactgtgagttaaagattctggattttggcctggcaaggcacacagatagt
gaaatgactggttacgtggtgaccagatggtacagagccccagaggttatactcaattgg
atgcactacactcagacagtggatatctggtctgttggatgtatcatggcagagatgtac
actgggaggccacttttcaagggaaatgaccatctagaccagctaacagaaataatgaaa
attactgggacaccaactcaggattttgtccagaagctccagagtcctgatgctaaaaac
tatatcaagagccttcctaaagtgcagaagaaagactttggatcattgctaagatatgca
aaccctcttgctgtaaatatccttgagaagatgttggtactggatgcagaaaagaggata
actgcgacagaggctttagcacatccatactttgaacagttccatgatattgatgatgag
acagaagctgaaccctatgatgattcattcgacaatgtaaatcttcctctggaggagtgg
aggcgtctcacacacaaggagcttactagctataagccattggtggctgattcaaaggaa
acatcggtataa

DBGET integrated database retrieval system