KEGG   Xenopus tropicalis (western clawed frog): 549867Help
Entry
549867            CDS       T01011                                 

Gene name
srd5a2, SRD5alpha2
Definition
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) (EC:1.3.99.5)
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    549867 (srd5a2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     549867 (srd5a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 239 aa AA seqDB search
MQCNQDMDYYMSLCLAIISVLFLIRQFTYPAAYGKHVATGKKQNGFMVPAKYGWFIQELP
SFLVPVVVILYRQQCNSLGCKMLSFMFCGHYFQRTFIYSAFTRGRPSPLRIVLMAVVFCT
YNGFLQGHCLVYVAEYPKDWCMDLRFISGVLIFCLGMGINIHSDHILRRLRKPSEVAYKI
PQGGMFNYVSGANFLGEIVEWFGYAIATWSLPGFAFAFFYSVLHWPEGLSSSQILPPKF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcaaccaggatatggactattatatgagcctgtgccttgccattattagcgtt
ctcttcctgatcagacagttcacttatcctgctgcttatggaaaacacgttgccactggc
aagaagcaaaatggtttcatggtcccagcaaagtatggctggtttatccaagagttaccc
tccttcctggtgccagttgtcgttatactgtacagacagcagtgcaactccctgggctgc
aagatgctttcattcatgttctgcggacactatttccaaaggacttttatctattctgct
ttcacaagaggaagaccatctcctctacgcatagttcttatggctgttgtattctgtaca
tataatggatttctacaaggacactgtctggtttatgtagctgaatatccaaaggactgg
tgtatggatctacgatttatatcaggtgtgttaatattctgtcttggaatggggatcaac
attcacagtgatcatattttacgcagattaagaaaacccagcgaggttgcatacaaaata
ccccaaggaggaatgtttaattatgtatctggggcaaatttccttggtgaaattgttgaa
tggtttggatatgctattgcaacatggtcactgccaggatttgcctttgcttttttttac
tctgtgttgcattggcccgagggcttatcatcatcacaaattttacctccaaagttttaa

DBGET integrated database retrieval system