KEGG   Xenopus tropicalis (western clawed frog): 549874Help
Entry
549874            CDS       T01011                                 

Gene name
uchl3, uchl4
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 230 aa AA seqDB search
MQSLRWLPLEANPDLMNQFLKQLGVGSSWQFVDVYGLDPELLSMIPRPVCAVLLLFPVTE
KYETFRAEEEEKIKSHGQKLDSSVYFMKQTIRNACGTIGLIHTVANNREKLDFECDSALK
KFLEESVSLSPEERARFLEKDESIRVTHENTAQEGQSEAPSLDDKVDLHFVAFAHIKGHL
YELDGRKPFPVNHGQTTEETMFEDAIEVCRNFMLRDPDELRFTVIAFSKA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccctgcgctggctgcccttggaagccaatcccgatttaatgaaccagtttctc
aaacagttaggtgttggctcaagctggcagttcgtagatgtctatggcttggaccctgaa
cttcttagcatgatccccagaccagtgtgtgctgttttactactcttcccagtgacagaa
aagtatgaaacattcagggcagaagaagaagaaaaaatcaaatcccatgggcaaaaattg
gattcttcagtttacttcatgaaacaaaccataagaaacgcctgtggtacaattggcctt
attcacacagtagcaaacaacagggagaagctggattttgaatgtgactctgctttaaag
aagtttcttgaagagtctgtttccctgagtccagaagaaagagccagattcctagaaaaa
gatgagagtatacgtgttacacatgagaacactgcccaggaaggacagtctgaggcaccg
agtttagatgataaagtagatttacacttcgttgcatttgctcatataaaaggacatctc
tatgagctagacggacgcaaacctttccccgtaaaccacggacaaacaaccgaagaaaca
atgtttgaggatgccatagaagtttgcagaaattttatgctgcgtgacccagatgaatta
cggtttaccgtgattgctttctccaaagcctaa

DBGET integrated database retrieval system