KEGG   Xenopus tropicalis (western clawed frog): 549881Help
Entry
549881            CDS       T01011                                 

Gene name
mapk1, erk, erk2, ert1, mapk, mapk2, mpk1, p38, p40, p41, p41mapk, p42mapk, prkm1, prkm2, xp42
Definition
mitogen-activated protein kinase 1 (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:xtr04012]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:xtr04350]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:xtr04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xtr04150]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xtr04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xtr04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
Cellular Processes; Cell communication; Adherens junction [PATH:xtr04520]
Cellular Processes; Cell communication; Gap junction [PATH:xtr04540]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xtr04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:xtr04621]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xtr04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xtr04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xtr04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xtr04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xtr04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xtr04270]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:xtr04320]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xtr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 361 aa AA seqDB search
MAAAGASSNPGGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKIS
PFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLK
TQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD
HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL
NHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFN
PHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPG
Y
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcaggggcctcgtctaaccccggcggggggccggagatggtgcgagggcag
gcgttcgacgtaggcccgcgatataccaacctgtcatatatcggggagggagcgtacggc
atggtttgttctgcctatgacaatgtaaacaaagtacgagttgctatcaagaaaatcagc
ccatttgagcatcagacatactgccagagaacactgagggagatcaaaatcttgctgcgt
tttaagcatgaaaacatcattggaattaatgacataattcgagctccaaccattgagcaa
atgaaagatgtgtatattgtgcaggatctcatggagacagatctctataaactcctgaag
actcagcatcttagcaatgaccacatctgctatttcttgtaccagatcctgagaggatta
aagtacatccattcagccaatgttctacatcgtgatcttaagccttcaaatttgctgctt
aacactacctgtgatcttaagatttgtgattttggattggctcgtgttgcagacccagac
catgatcacactggatttctcacagaatatgtagccactcgctggtacagagctcctgag
atcatgctgaattccaagggctataccaaatcgattgacatctggtctgttggctgcatt
cttgctgagatgctttctaatagacccatatttcctggaaaacattatcttgaccaactc
aatcacatacttggaattcttggatctccatctcaagaggacctaaactgtataatcaat
ttaaaagctaggaattacttgctttcccttcctcacaaaaataaggtgccatggaacaga
cttttccctaatgcagatcctaaagctctagatttattggacaagatgttgaccttcaac
ccccacaaaagaattgaagtagaggcagctttggctcatccctatctggaacaatattat
gacccaagtgatgagcctgtagctgaagctccctttaaatttgaaatggagcttgatgat
ttgcccaaggagacactgaaggagctaatttttgaagaaacggctagattccagccaggg
tactga

DBGET integrated database retrieval system