KEGG   Xenopus tropicalis (western clawed frog): 549896Help
Entry
549896            CDS       T01011                                 

Gene name
rae1, gle2, mig14, mnrp41, mrnp41
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    549896 (rae1)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     549896 (rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 368 aa AA seqDB search
MSLFSTPGGFGTGGGSMFGSTATDNHNPMKDIEVTSPPDDSISCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQS
IQIAQHDAPIKTVHWVKAPNYSCIMTGSWDKSLKFWDTRSPNPLLTLQLPERCYCADVVY
PMAVVATAERGLIVYQLENQPSEFRRIDSPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTTAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACSFNHNGNIFAYSSSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtttattttctacccctgggggatttggaaccgggggcggcagtatgttcggcagc
acagcgaccgataaccacaatcctatgaaggacatcgaagtcacgtcacccccagacgac
agcatctcgtgcctctcgttcagcccccccacgctgcccggcaacttcctaatcgccggt
tcctgggccaatgacgttcggtgctgggaagttcaggataacggacagaccattccgaag
gcgcaacagatgcacacaggccccgtgctggacgtctgctggagtgacgacgggagcaaa
gtgtttacagcctcgtgtgataaaactgccaaaatgtgggacctgaacagcaaccaatca
atacaaattgcacagcatgatgcccctataaagaccgtgcattgggtaaaggccccaaac
tacagctgtatcatgactgggagctgggataaaagtttgaagttttgggacacacggtcg
cctaacccattgctgactctgcaactcccagagcgatgttactgtgccgatgtggtgtac
cctatggctgttgtggccacggcggagagagggttaattgtgtatcagcttgagaaccag
ccctcagaatttagaagaatagactctccccttaaacatcagcacaggtgtgtcgctata
tttaaagacaagcagaacaaaccaactggttttgcactgggaagcattgaaggaagagtc
gccattcattatatcaacccccccaatccagccaaagacaacttcacgtttaaatgccac
cgctccaacggcacaaacaccaccgcccctcaggatatctacgccgtaaatggcattgct
ttccatcccgtacacggcactttggctacagtcggctcagacggccgattcagtttctgg
gacaaagatgcacggaccaaactgaagacgtcggagcagctggaccagccaatctccgct
tgttccttcaaccacaatggaaacatttttgcctattcgtccagctatgactggtccaag
ggccatgaattctacaacccacagaagaagaactatatcttcttgcgtaacgcggccgaa
gaattaaaaccgcggaataagaaatag

DBGET integrated database retrieval system