KEGG   Xenopus tropicalis (western clawed frog): 550060Help
Entry
550060            CDS       T01011                                 

Gene name
aldh18a1
Definition
(RefSeq) aldehyde dehydrogenase 18 family member A1
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00330  Arginine and proline metabolism
xtr01100  Metabolic pathways
xtr01230  Biosynthesis of amino acids
Module
xtr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    550060 (aldh18a1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     550060 (aldh18a1)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     550060 (aldh18a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 550060
NCBI-ProteinID: NP_001017306
Xenbase: XB-GENE-5765545
UniProt: Q28DF8
Position
7
AA seq 796 aa AA seqDB search
MLCRAALSSCVGTSARCLLARVRSTASSNLLHFPGSTHQTARHWSNIPFITVPHMRSHGK
PFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIVTSGA
VAFGKQRLRHEILLSQSVRQALHSGQNQLKDMQVPVLEARACAAAGQSGLMALYEAMFTQ
YSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVI
SIKDNDSLAARLAVEMKADLIIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKS
RVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVKPAGP
TVEQQAEMARTGGRSLATLLPEQRAEIIFHLADLLTDHREEILSANKKDMDEAEDKGRLA
APLLKRLSLSTAKLNSLSIGLRQIAASSQDSVGRVLRRTRIAKDLELEEVTVPIGVLLVI
FESRPDCLPQVSALAIASGNGLLLKGGKEAANTNQILYRLTQEALSLHGVRDAVQLVNTR
EEVEDLCRLNKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDSDASVDKVTR
IVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRVEQVKIHAGPRFASYLTFSPS
EVKSLRTEYGDLECCLEVVDGVQDAIEHIHKYGSSHTDAIITENEQTAEYFLQHVDSACV
FWNTSTRFSDGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWILRGENHVVSDFSEQGS
KKYLHEKLPVPQTSSS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcgggctgctctgagttcctgcgtgggcacctctgccagatgcctccttgca
agggtacgaagcacggcttcttccaacttgttacatttccctggctctactcatcagaca
gcccgtcattggagcaatatccctttcatcacggtgccacatatgcgctctcatgggaag
ccatttgcccaccgcagtgagctaaagcatgccaagcgaatcgtcgtgaagctgggaagc
gcagtagtgacaagaggggatgagtgcggcttagctcttgggaggctggcttctattgta
gaacaggtgtctgtgctgcagaaccagggcagagagatgatgatcgttaccagtggtgct
gtggcatttggaaagcaacgcctgcgccatgaaatcctcttgtcacagagtgtgcgccaa
gccttgcactcagggcagaaccagctgaaagatatgcaagttccagtgttggaagcccgt
gcttgtgccgcggccggccagagtggactcatggcgctatatgaagcaatgtttacacag
tacagtatttgtgctgctcagattttagtaacaaacctcgatttccacgatgagcaaaaa
cggaggaatttaaacggcactttacacgagctgcttcgaatgaacattgttcccatcata
aacaccaatgacgcagtggttcctcctccagaacccaatagtgatctgcagggggtaatc
agcattaaggacaatgatagtctggctgctcgactggctgttgaaatgaaagctgacctg
ataatcgtgttgtctgatgtagaaggactgtttgacagtccaccggggtcagatgacgct
aaactcatagacatcttttatcctggagaccagcagtcggtgacctttggaaccaaatct
cgagttggtatgggaggcatggaggcaaaggtgaaagcagctttatgggcgctacaaggc
ggtacctctgttgttattgcgaatggcactcacccaaagatctcaggtcatgtgatcact
gatattgtggaggggaagaaagttgggacttttttttcagaagtgaaaccagcaggtccc
actgtggaacagcaggcagagatggcacggacaggtggtaggagcttggcaaccttgcta
cctgagcagagagctgaaatcatttttcacttggctgacctactgactgaccacagagag
gagattctgtctgctaacaagaaggacatggacgaggcagaagataaaggaagattggct
gctcctttgctgaaacggttaagcttatccacagcgaagctaaacagtctgtccatcggg
cttcggcagatcgctgcctcttcacaagatagtgtaggccgagtgctgcgcagaacacgc
attgccaaggatctggaactggaggaagtgaccgtacccattggagtccttctagttatc
tttgagtccagaccagactgccttcctcaggtttctgcactggccattgctagtgggaat
ggtttgcttctgaaaggaggaaaggaggccgccaacaccaaccagatactctaccgactg
actcaggaagcattgtctcttcatggagttagggacgctgtgcagttggtgaacaccaga
gaagaagttgaagacctctgtcgtttaaacaaacttattgatctgatcataccacgtggt
tcctcacaattggtcagggacattcagaaagcagccaagggtattcccgtgatggggcac
agtgaaggaatatgccacgtgtatgtggattctgatgcaagtgttgacaaggtcacaaga
atcgtgcgggactccaagtgtgaatatccagctgcttgcaatgcaatggaaacactgctc
atccatagagatatactgagaaccccactgtttgaccagatcattgacatgctgagggtt
gaacaggttaaaatccatgccggtccaaggtttgcctcctacctgaccttcagcccctca
gaagtgaaatctctgcgtacagaatatggtgacttggagtgttgccttgaagtggtagat
ggagtccaggatgcaattgagcatattcacaagtatggaagttcccacacggatgctatt
atcacagagaatgaacaaacagcggagtattttctgcagcacgtggatagcgcttgtgtg
ttctggaataccagcactcgattttctgatggataccgatttggacttggagcggaggtg
ggaatcagcacagccaggatccatgcccgagggcctgtggggatagagggattgcttact
acaaaatggatactgagaggagaaaatcacgttgtgtctgacttttcagaacaagggagc
aagaaatatctacatgaaaagctccctgtgccacaaaccagttctagctaa

DBGET integrated database retrieval system