KEGG   Xenopus tropicalis (western clawed frog): 550060Help
Entry
550060            CDS       T01011                                 

Gene name
aldh18a1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xtr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xtr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 796 aa AA seqDB search
MLCRAALSSCVGTSARCLLARVRSTASSNLLHFPGSTHQTARHWSNIPFITVPHMRSHGK
PFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIVTSGA
VAFGKQRLRHEILLSQSVRQALHSGQNQLKDMQVPVLEARACAAAGQSGLMALYEAMFTQ
YSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVI
SIKDNDSLAARLAVEMKADLIIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKS
RVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVKPAGP
TVEQQAEMARTGGRSLATLLPEQRAEIIFHLADLLTDHREEILSANKKDMDEAEDKGRLA
APLLKRLSLSTAKLNSLSIGLRQIAASSQDSVGRVLRRTRIAKDLELEEVTVPIGVLLVI
FESRPDCLPQVSALAIASGNGLLLKGGKEAANTNQILYRLTQEALSLHGVRDAVQLVNTR
EEVEDLCRLNKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDSDASVDKVTR
IVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRVEQVKIHAGPRFASYLTFSPS
EVKSLRTEYGDLECCLEVVDGVQDAIEHIHKYGSSHTDAIITENEQTAEYFLQHVDSACV
FWNTSTRFSDGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWILRGENHVVSDFSEQGS
KKYLHEKLPVPQTSSS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcgggctgctctgagttcctgcgtgggcacctctgccagatgcctccttgca
agggtacgaagcacggcttcttccaacttgttacatttccctggctctactcatcagaca
gcccgtcattggagcaatatccctttcatcacggtgccacatatgcgctctcatgggaag
ccatttgcccaccgcagtgagctaaagcatgccaagcgaatcgtcgtgaagctgggaagc
gcagtagtgacaagaggggatgagtgcggcttagctcttgggaggctggcttctattgta
gaacaggtgtctgtgctgcagaaccagggcagagagatgatgatcgttaccagtggtgct
gtggcatttggaaagcaacgcctgcgccatgaaatcctcttgtcacagagtgtgcgccaa
gccttgcactcagggcagaaccagctgaaagatatgcaagttccagtgttggaagcccgt
gcttgtgccgcggccggccagagtggactcatggcgctatatgaagcaatgtttacacag
tacagtatttgtgctgctcagattttagtaacaaacctcgatttccacgatgagcaaaaa
cggaggaatttaaacggcactttacacgagctgcttcgaatgaacattgttcccatcata
aacaccaatgacgcagtggttcctcctccagaacccaatagtgatctgcagggggtaatc
agcattaaggacaatgatagtctggctgctcgactggctgttgaaatgaaagctgacctg
ataatcgtgttgtctgatgtagaaggactgtttgacagtccaccggggtcagatgacgct
aaactcatagacatcttttatcctggagaccagcagtcggtgacctttggaaccaaatct
cgagttggtatgggaggcatggaggcaaaggtgaaagcagctttatgggcgctacaaggc
ggtacctctgttgttattgcgaatggcactcacccaaagatctcaggtcatgtgatcact
gatattgtggaggggaagaaagttgggacttttttttcagaagtgaaaccagcaggtccc
actgtggaacagcaggcagagatggcacggacaggtggtaggagcttggcaaccttgcta
cctgagcagagagctgaaatcatttttcacttggctgacctactgactgaccacagagag
gagattctgtctgctaacaagaaggacatggacgaggcagaagataaaggaagattggct
gctcctttgctgaaacggttaagcttatccacagcgaagctaaacagtctgtccatcggg
cttcggcagatcgctgcctcttcacaagatagtgtaggccgagtgctgcgcagaacacgc
attgccaaggatctggaactggaggaagtgaccgtacccattggagtccttctagttatc
tttgagtccagaccagactgccttcctcaggtttctgcactggccattgctagtgggaat
ggtttgcttctgaaaggaggaaaggaggccgccaacaccaaccagatactctaccgactg
actcaggaagcattgtctcttcatggagttagggacgctgtgcagttggtgaacaccaga
gaagaagttgaagacctctgtcgtttaaacaaacttattgatctgatcataccacgtggt
tcctcacaattggtcagggacattcagaaagcagccaagggtattcccgtgatggggcac
agtgaaggaatatgccacgtgtatgtggattctgatgcaagtgttgacaaggtcacaaga
atcgtgcgggactccaagtgtgaatatccagctgcttgcaatgcaatggaaacactgctc
atccatagagatatactgagaaccccactgtttgaccagatcattgacatgctgagggtt
gaacaggttaaaatccatgccggtccaaggtttgcctcctacctgaccttcagcccctca
gaagtgaaatctctgcgtacagaatatggtgacttggagtgttgccttgaagtggtagat
ggagtccaggatgcaattgagcatattcacaagtatggaagttcccacacggatgctatt
atcacagagaatgaacaaacagcggagtattttctgcagcacgtggatagcgcttgtgtg
ttctggaataccagcactcgattttctgatggataccgatttggacttggagcggaggtg
ggaatcagcacagccaggatccatgcccgagggcctgtggggatagagggattgcttact
acaaaatggatactgagaggagaaaatcacgttgtgtctgacttttcagaacaagggagc
aagaaatatctacatgaaaagctccctgtgccacaaaccagttctagctaa

DBGET integrated database retrieval system