KEGG   Xenopus tropicalis (western clawed frog): 550094Help
Entry
550094            CDS       T01011                                 

Definition
uncharacterized LOC550094
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     550094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 525 aa AA seqDB search
MAPAGRCCWERKMLLSLLLLIICPSCLISIKISPLIEKIDDHKDFKKLLRTRNNVLVLYS
KSASAAEQQLKFLSNIAQDVKGRATVSWIDCGDAEGRKLCKKLKVDPSKKPNGVELLHYK
DGTFHTEYNRPNTHKSLIAFLKDPEGAPLWEENPDAKDVVHIDNEKDFRKFLKREDRPLL
LMFYAPWCGVCKRLMPSYQQAAANLKGSYVLAGMNIHPPEFDRLKEEYSVKGYPTVLYFE
KGKYMFNFEKYGASAQDIADWLKNPQAPTPEAPEVAWSETDNPVYHLTDADFDQFLAEHP
SVLVMFYAPWCGHCKKMKPDYEKAAETLHAESGAGVLAAVDSTVHRAVSEKFKVTGFPTV
KYFENGEEKYTVPHLRTEQKIVEWMHNPEAPPPPELSWDEKPSSVLHLVGDEFREALKKK
KHSLVMFYAPWCPHCKSTIPDFTTAADTFKEDRKIAYGAVDCTKEKNQELCKQEGVEGFP
TYNCYNYGKFSEKYSGERTESGFIGFVKSLREKDQSKLGKKKDEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgccgggcgctgctgctgggagaggaagatgctgctgtcgctgctgctcctg
attatctgcccctcgtgcctcatctccattaagatttcccccctcattgagaaaatcgat
gaccacaaagacttcaagaagcttctgcgcacgaggaacaatgtgctggttctgtactca
aagtcagcctcggcagcggagcagcagctcaaattcctgtccaacatcgctcaggacgtt
aaggggagggcgactgtgtcatggatcgactgtggcgacgccgagggcaggaagctgtgc
aagaagctgaaggtggatcccagcaagaagcccaatggggtggagctgctccattacaag
gacgggaccttccatacagaatacaacagaccaaacacacacaagtcgctcattgccttc
ctgaaggacccagaaggggccccactgtgggaagagaatcccgatgccaaagacgttgta
catattgataacgagaaggatttccggaagtttctgaagagggaagatcgcccgctgctg
ctgatgttttacgccccgtggtgcggcgtttgcaagcggctgatgccatcgtaccagcag
gctgccgccaatctgaagggctcttatgtcctggcagggatgaacattcacccccctgag
ttcgaccggctgaaggaagagtacagcgtgaagggctacccgaccgtgctttatttcgag
aaggggaagtatatgttcaacttcgagaagtacggagcctccgcccaggacatcgctgat
tggctgaaaaaccctcaggcccccaccccggaggcccccgaggtcgcttggtcggagacg
gacaacccagtttaccacctgacggacgcagatttcgaccagtttttggcagaacacccc
tctgtgctggtcatgttctacgccccatggtgcggccactgtaagaagatgaaacctgac
tatgagaaggcggcagagacccttcatgccgagagtggggccggcgtattggcagcagtc
gattctacggtgcacagagccgtgtcggagaaattcaaagtcaccggattccccacagtg
aagtattttgagaacggcgaggagaaatacacggtgccgcatctgcgcacggagcagaag
atcgtggagtggatgcacaaccccgaggcgccgccccccccagagctttcctgggatgag
aaaccctccagcgttctgcacctcgtgggggacgagttccgtgaagccctgaagaagaag
aaacattcactggtcatgttctatgccccctggtgcccccactgtaagagcacaatccca
gacttcacaacagctgccgatacctttaaggaagatagaaagattgcatacggcgctgtg
gactgcaccaaagagaaaaaccaggagttgtgtaagcaggagggggtggaaggattcccg
acctacaactgctacaactacggaaagttctccgagaaatacagcggggaacgaacagaa
tccggatttattggttttgtaaagtctctccgtgagaaagatcagtctaaactgggcaag
aagaaggatgaattgtaa

DBGET integrated database retrieval system