KEGG   Xenopus tropicalis (western clawed frog): 550102Help
Entry
550102            CDS       T01011                                 

Gene name
cyp4b1.2, cyp4b1
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     550102 (cyp4b1.2)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP4 family
   550102 (cyp4b1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 515 aa AA seqDB search
MASTLWKALSSPWLSVNIYQIGQFVALLCVVLLLLKAYALYSRGRRFAAALVPFPGPPAH
WLYGHVNQFRRDGKDLDRLMVWVNKYPNAFPLWIGKFFGTLIITDPDYAKVVFGRSDPKT
STGYNFLVPWIGKGLLILSGNTWFQHRRLITPGFHYDVLKPYVSLISDSTKIMLDELDVY
SNKDESVELFQHVSLMTLDSIMKCAFSYHSNCQTDKDNDYIQAVYDLSWLTQQRIRTFPY
HSNLIYFLSPHGFRFRKACRIVHLHTDKVIGQRKKLLESKEELEKVQKKRHLDFLDILLC
SKDENGQGLSHEDLRAEVDTFMFEGHDTTSSGISWILYCMATHPEHQQKCREEISEALGE
RQTMEWDDLNRMPYTTMCIKESLRLYPPVPSVSRELAKPITFHDGRSLPAGMLVSLQIYA
IHRNPNVWKDPEIFDPLRFSPENSSKRHSHAFVPFAAGPRNCIGQNFAMNEMKVAVALTL
KRFELSPDLSKPPLKQPQLVLRSKNGIHVYLKKAS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccactctgtggaaagcgctgagtagcccatggctgtctgtgaatatctaccag
attggccaatttgttgcattactatgcgtggtgctgctcctactaaaagcctatgcactc
tatagcagggggaggagatttgccgcagctctagtccccttccccggacctccagctcac
tggctgtatggacatgtcaatcagtttcgtcgtgatggaaaagatcttgataggttaatg
gtgtgggtgaataaatatccaaacgcctttcctttgtggattggaaaattctttggcact
cttatcatcactgacccagactatgcaaaggttgtatttggaagatcagatcccaaaaca
tctactgggtataattttctggttccatggattgggaaagggctgctcattctttctggg
aatacttggttccaacatcgtagactgatcaccccagggtttcattacgatgttctgaaa
ccttatgtcagtctcatatctgattccacaaaaatcatgctggatgaattggatgtctat
agcaataaggatgaatccgtggagctattccagcatgtcagcttaatgacactggacagc
atcatgaaatgtgccttcagttaccatagtaactgtcagaccgacaaagataatgactac
attcaagctgtatatgatctgtcctggttgactcagcagcggattcgcacctttccttat
cacagtaacctaatatattttctgagtcctcatggtttccgttttcgcaaagcctgcaga
atagtacatctccacactgataaagttattggacagaggaaaaagctcttggaaagcaag
gaagagttggaaaaggtccaaaagaagaggcacttggattttctagacattcttctctgt
tccaaggatgaaaatgggcaaggtctttctcatgaggatctgcgtgctgaggtagacaca
ttcatgtttgagggacatgataccacatctagtggaatatcctggatcttatattgtatg
gctacacatccagaacaccagcagaaatgccgggaggagatcagtgaagccttgggggag
cggcaaaccatggaatgggatgaccttaacaggatgccttataccacaatgtgcattaag
gaaagtctgcgcctatatcctccagtcccatccgtatccagggagcttgccaaaccaata
acattccatgatggacggtcattaccagcaggtatgttggtgagtctacagatttatgct
attcaccgaaatcccaatgtgtggaaggatccagagatatttgatcctctccgattttcg
ccagaaaattcttccaagaggcattcccatgcttttgtgccttttgctgcaggaccaagg
aactgcatcggacagaactttgctatgaatgagatgaaagtggctgttgcactgactctg
aaacgctttgagctgtcaccagatctttccaagcctcccctcaagcagccacaacttgtt
ctgcgctccaaaaatggtatccacgtgtatctgaaaaaagcaagttga

DBGET integrated database retrieval system