KEGG   Xenopus tropicalis (western clawed frog): 550102Help
Entry
550102            CDS       T01011                                 

Gene name
cyp4b1.2, cyp4b1
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 515 aa AA seqDB search
MASTLWKALSSPWLSVNIYQIGQFVALLCVVLLLLKAYALYSRGRRFAAALVPFPGPPAH
WLYGHVNQFRRDGKDLDRLMVWVNKYPNAFPLWIGKFFGTLIITDPDYAKVVFGRSDPKT
STGYNFLVPWIGKGLLILSGNTWFQHRRLITPGFHYDVLKPYVSLISDSTKIMLDELDVY
SNKDESVELFQHVSLMTLDSIMKCAFSYHSNCQTDKDNDYIQAVYDLSWLTQQRIRTFPY
HSNLIYFLSPHGFRFRKACRIVHLHTDKVIGQRKKLLESKEELEKVQKKRHLDFLDILLC
SKDENGQGLSHEDLRAEVDTFMFEGHDTTSSGISWILYCMATHPEHQQKCREEISEALGE
RQTMEWDDLNRMPYTTMCIKESLRLYPPVPSVSRELAKPITFHDGRSLPAGMLVSLQIYA
IHRNPNVWKDPEIFDPLRFSPENSSKRHSHAFVPFAAGPRNCIGQNFAMNEMKVAVALTL
KRFELSPDLSKPPLKQPQLVLRSKNGIHVYLKKAS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccactctgtggaaagcgctgagtagcccatggctgtctgtgaatatctaccag
attggccaatttgttgcattactatgcgtggtgctgctcctactaaaagcctatgcactc
tatagcagggggaggagatttgccgcagctctagtccccttccccggacctccagctcac
tggctgtatggacatgtcaatcagtttcgtcgtgatggaaaagatcttgataggttaatg
gtgtgggtgaataaatatccaaacgcctttcctttgtggattggaaaattctttggcact
cttatcatcactgacccagactatgcaaaggttgtatttggaagatcagatcccaaaaca
tctactgggtataattttctggttccatggattgggaaagggctgctcattctttctggg
aatacttggttccaacatcgtagactgatcaccccagggtttcattacgatgttctgaaa
ccttatgtcagtctcatatctgattccacaaaaatcatgctggatgaattggatgtctat
agcaataaggatgaatccgtggagctattccagcatgtcagcttaatgacactggacagc
atcatgaaatgtgccttcagttaccatagtaactgtcagaccgacaaagataatgactac
attcaagctgtatatgatctgtcctggttgactcagcagcggattcgcacctttccttat
cacagtaacctaatatattttctgagtcctcatggtttccgttttcgcaaagcctgcaga
atagtacatctccacactgataaagttattggacagaggaaaaagctcttggaaagcaag
gaagagttggaaaaggtccaaaagaagaggcacttggattttctagacattcttctctgt
tccaaggatgaaaatgggcaaggtctttctcatgaggatctgcgtgctgaggtagacaca
ttcatgtttgagggacatgataccacatctagtggaatatcctggatcttatattgtatg
gctacacatccagaacaccagcagaaatgccgggaggagatcagtgaagccttgggggag
cggcaaaccatggaatgggatgaccttaacaggatgccttataccacaatgtgcattaag
gaaagtctgcgcctatatcctccagtcccatccgtatccagggagcttgccaaaccaata
acattccatgatggacggtcattaccagcaggtatgttggtgagtctacagatttatgct
attcaccgaaatcccaatgtgtggaaggatccagagatatttgatcctctccgattttcg
ccagaaaattcttccaagaggcattcccatgcttttgtgccttttgctgcaggaccaagg
aactgcatcggacagaactttgctatgaatgagatgaaagtggctgttgcactgactctg
aaacgctttgagctgtcaccagatctttccaagcctcccctcaagcagccacaacttgtt
ctgcgctccaaaaatggtatccacgtgtatctgaaaaaagcaagttga

DBGET integrated database retrieval system