KEGG   Xenopus tropicalis (western clawed frog): 594934Help
Entry
594934            CDS       T01011                                 

Gene name
dck.1, dck
Definition
deoxycytidine kinase, gene 1 (EC:2.7.1.74)
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    594934 (dck.1)
   00240 Pyrimidine metabolism
    594934 (dck.1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     594934 (dck.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 265 aa AA seqDB search
MATPPKRICIDLPPSPSGKNCKVKRISIEGNIAAGKSTFVNILKKANEDWEVVPEPIARW
CNIQSCKDEFEELTTSQKSGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKALGGKLKE
AENPVLFFERSVYSDRYIFASNLYEAECMNETEWTVYQDWHDWMNSQFGADLELDGIIYL
RAIPEKCLNRIYSRGREEEQGIPMEYLEKLHYKHESWLHHRTMRTDFEYLQEIPILTLDV
NEDFKDNKQKQESLIEKVKEFLSTL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccactccaccgaaacggatttgcatcgacttgccgccatccccttcaggcaagaac
tgcaaggttaaaaggatttccatagaggggaacatcgctgctgggaaatctacctttgtg
aatattctcaaaaaggccaatgaagactgggaggttgttcctgagcccatagcaagatgg
tgcaatatacagagctgcaaagatgaatttgaggaactaaccacctctcagaaaagtgga
ggtaatctactacagatgatgtatgaaaagccagagcgctggtccttcacttttcagtcc
tatgcttgtttgagccgaatcagggcccagctgaaggctttgggagggaagctaaaagaa
gcagaaaacccggtgctcttttttgaacgttcagtttatagtgacaggtatatctttgca
tccaatttgtatgaggcagagtgcatgaatgaaactgaatggactgtttaccaggattgg
catgactggatgaattctcagtttggtgcagatcttgaactagatggaattatttatctc
cgtgctatcccagagaaatgtttaaacaggatttactcccgtggtagggaggaagaacaa
ggaattcccatggaatacttggaaaaacttcattacaagcatgagagctggctccatcac
agaactatgagaacggattttgagtaccttcaagaaatccccatcctgactttggatgtt
aatgaagatttcaaagataataaacagaagcaagagagcctaattgaaaaggtaaaggaa
tttttgagcactttatag

DBGET integrated database retrieval system