KEGG   Xenopus tropicalis (western clawed frog): 594953Help
Entry
594953            CDS       T01011                                 

Gene name
hdac1, HD1, gon-10, hdac1-b, rpd3, rpd3l1
Definition
histone deacetylase 1 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    594953 (hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    594953 (hdac1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     594953 (hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 480 aa AA seqDB search
MALSQGTKKKVCYYYDGDVGNYYYGQGHPIKPHRIRMTHNLLLNYGLYRKMEIYRPHKAS
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
SVKLNKQQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEFIKTFNLPLLMLGG
GGYTIRNVARCWTYETAVALDSEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDSVHDDSGEEDEEDPDKRISIRSSDKRIACDEEF
SDSEDEGEGGRRNVASFKKVKRVKTEEEKDGEEKKDVKEEEKPKDEKTDSKRVKEETKSA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagtcaaggaacaaagaagaaagtgtgctattactatgatggtgatgttgga
aattattattatggacaggggcatcccataaaacctcatagaattcgtatgacacacaac
ctgctgctgaactatggactttaccggaaaatggagatctatagaccccacaaagccagt
gcagaagagatgacaaagtatcacagtgatgattatataaaattcctgcgctccatacga
ccagacaatatgtccgaatacagtaaacagatgcagagatttaatgttggtgaggactgt
ccagtgtttgatggcttgtttgaattctgccaactctccacggggggctctgtagcaagc
tctgttaaactaaacaaacaacagacggacatttcagtaaactggtctggtggccttcat
catgccaagaaatctgaggcatctggtttttgttatgtcaacgatattgtccttgccatc
ctggaactattgaagtatcaccagagagttctgtatattgatatagacattcaccacggt
gatggtgtggaggaggccttttacacaactgatagagttatgacagtatccttccacaag
tatggagagtattttcctggaactggtgatctgagagatattggtgcagggaaaggcaaa
tattatgctgtgaattatcccttacgggatggaattgatgatgagtcctatgaagcaatt
tttaaaccagtaatgtctaaagttatggagatgtaccagcccagtgcagtggtcctacag
tgtggagcagattccttatccggggatagacttggatgtttcaatttgaccatcaaagga
catgccaagtgtgtggagttcataaagacctttaacttgccactgcttatgctaggaggt
ggaggttacactatcaggaatgtggctcgttgctggacatatgaaacagctgtggctctg
gactctgagatccctaatgagcttccatacaatgattattttgaatattttgggccagac
ttcaagcttcatatcagtccatccaacatgaccaatcagaacactaatgaatatctggag
aaaatcaagcagcgcctttttgagaacttgcgcatgcttcctcatgctccaggagtccag
atgcaagccatcccagaggactctgtacatgatgacagtggtgaagaagatgaggaagat
cctgacaagcgcatttccattcggtcatcggataaaaggattgcgtgtgatgaggagttc
tctgattctgaagatgaaggggaaggaggtcgcagaaacgtggccagtttcaagaaagta
aaacgggttaaaacagaggaggaaaaggatggagaagaaaagaaagatgttaaagaagag
gagaaacctaaagatgagaagacagacagcaaacgggtaaaagaagagaccaaatctgcc
tga

DBGET integrated database retrieval system