KEGG   Xenopus tropicalis (western clawed frog): 594969Help
Entry
594969            CDS       T01011                                 

Gene name
adh1c, ADH10A, adh3
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xtr00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:xtr00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xtr00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xtr00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:xtr00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:xtr00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 376 aa AA seqDB search
MDTAGKVIKCKAAVIWEKSAPFSIEEVEVAPPKANEVRIKIVATGICRSDDHAIEGKLST
VKFPVILGHEGVGIVESTGESVKHIKPGDRVIPLFVPQCGQCICCKDPRSNMCIAGKMKK
AVGLMSDGTSRFTCKGKQIYHFMNTSTFTEYTVAEEMSVAKIDSGASLDNTCLIGCGFST
GYGSALNSAKVHPGSTCAIFGLGGIGLAVIMGCKIAGAARIIGVDINPDKFNIAKELGAT
ECINPKDYDKPVPQVILEQTGGGVDYAFECVGHIETMLAALNSSHFAYGTTVIVGVSAPD
STISFDPMILLTGRTIKGSVFGGWKSKNSVPQLVSDSLAKKFDLEKLVTHRLPLNKINEG
FDLLRSGKSIRTILLV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggatacagcaggaaaggtgataaaatgcaaagcagcagtgatatgggagaaaagtgca
cccttctctattgaggaagttgaagtggcccccccaaaggccaatgaagtccgtataaag
attgtcgctactggtatttgccggtccgatgatcatgcaattgaggggaaactgagtaca
gtaaaattcccagttatacttggccatgaaggtgttggtattgtggagagcactggagaa
agtgttaagcacattaagccaggagatagagtcatcccactttttgtacctcaatgtgga
caatgtatatgttgcaaagacccaaggagtaatatgtgcattgcaggcaaaatgaaaaaa
gctgtaggactcatgtcggacggcaccagcagatttacctgcaaagggaagcaaatctac
cacttcatgaacaccagcacttttactgaatacactgtagctgaggaaatgtcagttgct
aagatcgacagtggtgcatccctagataatacctgtctcattggatgtggcttctccact
ggatatgggtctgcattaaattccgccaaggtgcacccagggtctacttgtgccatattt
ggtttaggaggaattggccttgctgtcattatgggctgtaagatagctggggcagctcgc
atcattggagtagatatcaatcctgacaaattcaacatagcaaaggaactaggagcgact
gaatgtataaaccccaaggattatgataaaccagtaccacaagtgattctggagcagact
ggaggtggcgtggactatgcatttgaatgtgttgggcacattgagaccatgctagctgcc
cttaactcaagtcattttgcatatggcacaacagtgatagtcggagtgtctgcaccagat
tcaaccatctcctttgatccaatgatcctgctgactgggcgcacaattaaaggctctgtc
tttggaggctggaagagtaagaattctgttccacaactggtttcagattctttggcaaag
aaattcgaccttgaaaagttggtaacccatcgattaccattaaataaaattaatgaaggg
tttgatcttttacgttctggaaagagtattcgaacaatcttgttggtttaa

DBGET integrated database retrieval system