KEGG   Xenopus tropicalis (western clawed frog): 594969Help
Entry
594969            CDS       T01011                                 

Gene name
adh1c, ADH10A, adh3
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    594969 (adh1c)
  Lipid metabolism
   00071 Fatty acid degradation
    594969 (adh1c)
  Amino acid metabolism
   00350 Tyrosine metabolism
    594969 (adh1c)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    594969 (adh1c)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    594969 (adh1c)
   00982 Drug metabolism - cytochrome P450
    594969 (adh1c)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     594969 (adh1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 376 aa AA seqDB search
MDTAGKVIKCKAAVIWEKSAPFSIEEVEVAPPKANEVRIKIVATGICRSDDHAIEGKLST
VKFPVILGHEGVGIVESTGESVKHIKPGDRVIPLFVPQCGQCICCKDPRSNMCIAGKMKK
AVGLMSDGTSRFTCKGKQIYHFMNTSTFTEYTVAEEMSVAKIDSGASLDNTCLIGCGFST
GYGSALNSAKVHPGSTCAIFGLGGIGLAVIMGCKIAGAARIIGVDINPDKFNIAKELGAT
ECINPKDYDKPVPQVILEQTGGGVDYAFECVGHIETMLAALNSSHFAYGTTVIVGVSAPD
STISFDPMILLTGRTIKGSVFGGWKSKNSVPQLVSDSLAKKFDLEKLVTHRLPLNKINEG
FDLLRSGKSIRTILLV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggatacagcaggaaaggtgataaaatgcaaagcagcagtgatatgggagaaaagtgca
cccttctctattgaggaagttgaagtggcccccccaaaggccaatgaagtccgtataaag
attgtcgctactggtatttgccggtccgatgatcatgcaattgaggggaaactgagtaca
gtaaaattcccagttatacttggccatgaaggtgttggtattgtggagagcactggagaa
agtgttaagcacattaagccaggagatagagtcatcccactttttgtacctcaatgtgga
caatgtatatgttgcaaagacccaaggagtaatatgtgcattgcaggcaaaatgaaaaaa
gctgtaggactcatgtcggacggcaccagcagatttacctgcaaagggaagcaaatctac
cacttcatgaacaccagcacttttactgaatacactgtagctgaggaaatgtcagttgct
aagatcgacagtggtgcatccctagataatacctgtctcattggatgtggcttctccact
ggatatgggtctgcattaaattccgccaaggtgcacccagggtctacttgtgccatattt
ggtttaggaggaattggccttgctgtcattatgggctgtaagatagctggggcagctcgc
atcattggagtagatatcaatcctgacaaattcaacatagcaaaggaactaggagcgact
gaatgtataaaccccaaggattatgataaaccagtaccacaagtgattctggagcagact
ggaggtggcgtggactatgcatttgaatgtgttgggcacattgagaccatgctagctgcc
cttaactcaagtcattttgcatatggcacaacagtgatagtcggagtgtctgcaccagat
tcaaccatctcctttgatccaatgatcctgctgactgggcgcacaattaaaggctctgtc
tttggaggctggaagagtaagaattctgttccacaactggtttcagattctttggcaaag
aaattcgaccttgaaaagttggtaacccatcgattaccattaaataaaattaatgaaggg
tttgatcttttacgttctggaaagagtattcgaacaatcttgttggtttaa

DBGET integrated database retrieval system