KEGG   Xenopus tropicalis (western clawed frog): 594971Help
Entry
594971            CDS       T01011                                 

Gene name
xiap, api3, birc4, ilp1, miha, xlp2, xxiap
Definition
(RefSeq) X-linked inhibitor of apoptosis (EC:6.3.2.-)
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    594971 (xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    594971 (xiap)
  Cellular community - eukaryotes
   04510 Focal adhesion
    594971 (xiap)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    594971 (xiap)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     594971 (xiap)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    594971 (xiap)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    594971 (xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 492 aa AA seqDB search
MEPQLAEFVLKEEMTCQCPKMSDGAYDMDVDQNYFEEEVRLASFANFPSSYPVSAPALAR
AGFYYTGDGDRVKCFSCLAMVEGWQHGDTAIGKHRKISPNCKFINGFNNLRSDCILTQVP
VMQNGFQNSAEDLAERSSSEIMADYLLRTGRVVDMSTPKYPRHMEMCSEEARLQTFQNWP
AYSPLTPKELANAGLFYTGINDQVKCFCCGGKLMNWEPSDKAWTEHKKHFPECYFVLGRD
VGNVATEANTHGGRRRGSELACPAMNDYNARLETFSSWSFPIDKETLAKAGFYSIGDGDA
TKCFHCGGVLNCWSATDDPWEEHAKAYPGCKFLIDEKGQHFINHAQLKRPILHKANSADA
SPALPKDSNLLKSPLVTDAQQMGFPLEEIKKVMGQKLKTTGKNYTCVEEFVSDLCAQKET
VLEKPKEIEISLEEKLRQLEEEKICKVCMDRRISIVFIPCGHLVACAVCADVLDKCPICC
TIVERRQKIFMS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcaacttgctgaatttgttcttaaagaggaaatgacatgccagtgtccgaag
atgtcagacggtgcttatgatatggatgtggaccagaattattttgaagaggaagtcaga
ctggcgtcctttgctaacttcccaagtagctacccggtctctgctccagcactagcgcgg
gccggcttctattacactggagatggagatcgagtcaagtgttttagctgcctggctatg
gttgaaggctggcagcatggagacacggcaattggcaagcaccggaaaatatccccaaac
tgtaaatttattaatggctttaataacttacgaagtgattgtatcctaactcaagtgcct
gtcatgcagaatggttttcagaattccgctgaagacttggctgagagatctagttctgag
attatggcagactacttgctaaggactggaagagttgtcgatatgtcaacaccaaaatat
cccaggcatatggaaatgtgtagtgaggaagcccgactgcaaacgtttcaaaactggcca
gcctattcacccttaacaccaaaagagctagccaatgcaggtcttttttatacaggcatc
aacgaccaagtcaaatgcttttgctgtggtggaaaactaatgaactgggaacctagtgac
aaagcgtggacagaacacaaaaaacattttcctgaatgctactttgttttgggccgtgat
gttggcaatgtggctaccgaagccaatacacatggtggtaggagaagaggttctgagttg
gcctgcccagccatgaacgactacaatgctcgtcttgagaccttttcatcatggtcattt
ccaattgacaaggaaacactcgctaaagctggattttatagtataggtgacggagatgcc
acaaagtgctttcattgtgggggagtgttaaattgttggtcggcaacagatgatccttgg
gaagagcatgccaaggcatatcctggatgcaagttcctgattgatgaaaagggacagcac
tttataaaccatgcccagttaaagagacccattctacacaaggcaaactctgcagacgca
tcacctgcattacccaaagacagcaatttattgaagagcccattggtgaccgatgcccag
caaatgggatttcctcttgaagaaataaagaaagttatggggcagaagctgaagaccaca
gggaaaaattatacatgtgtggaagaatttgtctctgacttgtgtgctcagaaagaaaca
gttttagagaagcccaaggaaattgagatcagccttgaagagaaactgaggcaactagag
gaggagaagatctgcaaagtttgtatggacaggcggatctccattgttttcataccctgc
ggccaccttgtggcctgtgctgtatgtgcagatgtgcttgataaatgtccaatctgttgc
actattgtagaaagaagacagaaaatttttatgtcatag

DBGET integrated database retrieval system