KEGG   Xenopus tropicalis (western clawed frog): 594971Help
Entry
594971            CDS       T01011                                 

Gene name
xiap, api3, birc4, ilp1, miha, xlp2, xxiap
Definition
X-linked inhibitor of apoptosis (EC:6.3.2.-)
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:xtr04120]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xtr04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 492 aa AA seqDB search
MEPQLAEFVLKEEMTCQCPKMSDGAYDMDVDQNYFEEEVRLASFANFPSSYPVSAPALAR
AGFYYTGDGDRVKCFSCLAMVEGWQHGDTAIGKHRKISPNCKFINGFNNLRSDCILTQVP
VMQNGFQNSAEDLAERSSSEIMADYLLRTGRVVDMSTPKYPRHMEMCSEEARLQTFQNWP
AYSPLTPKELANAGLFYTGINDQVKCFCCGGKLMNWEPSDKAWTEHKKHFPECYFVLGRD
VGNVATEANTHGGRRRGSELACPAMNDYNARLETFSSWSFPIDKETLAKAGFYSIGDGDA
TKCFHCGGVLNCWSATDDPWEEHAKAYPGCKFLIDEKGQHFINHAQLKRPILHKANSADA
SPALPKDSNLLKSPLVTDAQQMGFPLEEIKKVMGQKLKTTGKNYTCVEEFVSDLCAQKET
VLEKPKEIEISLEEKLRQLEEEKICKVCMDRRISIVFIPCGHLVACAVCADVLDKCPICC
TIVERRQKIFMS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcaacttgctgaatttgttcttaaagaggaaatgacatgccagtgtccgaag
atgtcagacggtgcttatgatatggatgtggaccagaattattttgaagaggaagtcaga
ctggcgtcctttgctaacttcccaagtagctacccggtctctgctccagcactagcgcgg
gccggcttctattacactggagatggagatcgagtcaagtgttttagctgcctggctatg
gttgaaggctggcagcatggagacacggcaattggcaagcaccggaaaatatccccaaac
tgtaaatttattaatggctttaataacttacgaagtgattgtatcctaactcaagtgcct
gtcatgcagaatggttttcagaattccgctgaagacttggctgagagatctagttctgag
attatggcagactacttgctaaggactggaagagttgtcgatatgtcaacaccaaaatat
cccaggcatatggaaatgtgtagtgaggaagcccgactgcaaacgtttcaaaactggcca
gcctattcacccttaacaccaaaagagctagccaatgcaggtcttttttatacaggcatc
aacgaccaagtcaaatgcttttgctgtggtggaaaactaatgaactgggaacctagtgac
aaagcgtggacagaacacaaaaaacattttcctgaatgctactttgttttgggccgtgat
gttggcaatgtggctaccgaagccaatacacatggtggtaggagaagaggttctgagttg
gcctgcccagccatgaacgactacaatgctcgtcttgagaccttttcatcatggtcattt
ccaattgacaaggaaacactcgctaaagctggattttatagtataggtgacggagatgcc
acaaagtgctttcattgtgggggagtgttaaattgttggtcggcaacagatgatccttgg
gaagagcatgccaaggcatatcctggatgcaagttcctgattgatgaaaagggacagcac
tttataaaccatgcccagttaaagagacccattctacacaaggcaaactctgcagacgca
tcacctgcattacccaaagacagcaatttattgaagagcccattggtgaccgatgcccag
caaatgggatttcctcttgaagaaataaagaaagttatggggcagaagctgaagaccaca
gggaaaaattatacatgtgtggaagaatttgtctctgacttgtgtgctcagaaagaaaca
gttttagagaagcccaaggaaattgagatcagccttgaagagaaactgaggcaactagag
gaggagaagatctgcaaagtttgtatggacaggcggatctccattgttttcataccctgc
ggccaccttgtggcctgtgctgtatgtgcagatgtgcttgataaatgtccaatctgttgc
actattgtagaaagaagacagaaaatttttatgtcatag

DBGET integrated database retrieval system