KEGG   Xenopus tropicalis (western clawed frog): 594971Help
Entry
594971            CDS       T01011                                 

Gene name
xiap, api3, birc4, ilp1, miha, xlp2, xxiap
Definition
X-linked inhibitor of apoptosis (EC:6.3.2.-)
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    594971 (xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    594971 (xiap)
  Cell communication
   04510 Focal adhesion
    594971 (xiap)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    594971 (xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 492 aa AA seqDB search
MEPQLAEFVLKEEMTCQCPKMSDGAYDMDVDQNYFEEEVRLASFANFPSSYPVSAPALAR
AGFYYTGDGDRVKCFSCLAMVEGWQHGDTAIGKHRKISPNCKFINGFNNLRSDCILTQVP
VMQNGFQNSAEDLAERSSSEIMADYLLRTGRVVDMSTPKYPRHMEMCSEEARLQTFQNWP
AYSPLTPKELANAGLFYTGINDQVKCFCCGGKLMNWEPSDKAWTEHKKHFPECYFVLGRD
VGNVATEANTHGGRRRGSELACPAMNDYNARLETFSSWSFPIDKETLAKAGFYSIGDGDA
TKCFHCGGVLNCWSATDDPWEEHAKAYPGCKFLIDEKGQHFINHAQLKRPILHKANSADA
SPALPKDSNLLKSPLVTDAQQMGFPLEEIKKVMGQKLKTTGKNYTCVEEFVSDLCAQKET
VLEKPKEIEISLEEKLRQLEEEKICKVCMDRRISIVFIPCGHLVACAVCADVLDKCPICC
TIVERRQKIFMS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcaacttgctgaatttgttcttaaagaggaaatgacatgccagtgtccgaag
atgtcagacggtgcttatgatatggatgtggaccagaattattttgaagaggaagtcaga
ctggcgtcctttgctaacttcccaagtagctacccggtctctgctccagcactagcgcgg
gccggcttctattacactggagatggagatcgagtcaagtgttttagctgcctggctatg
gttgaaggctggcagcatggagacacggcaattggcaagcaccggaaaatatccccaaac
tgtaaatttattaatggctttaataacttacgaagtgattgtatcctaactcaagtgcct
gtcatgcagaatggttttcagaattccgctgaagacttggctgagagatctagttctgag
attatggcagactacttgctaaggactggaagagttgtcgatatgtcaacaccaaaatat
cccaggcatatggaaatgtgtagtgaggaagcccgactgcaaacgtttcaaaactggcca
gcctattcacccttaacaccaaaagagctagccaatgcaggtcttttttatacaggcatc
aacgaccaagtcaaatgcttttgctgtggtggaaaactaatgaactgggaacctagtgac
aaagcgtggacagaacacaaaaaacattttcctgaatgctactttgttttgggccgtgat
gttggcaatgtggctaccgaagccaatacacatggtggtaggagaagaggttctgagttg
gcctgcccagccatgaacgactacaatgctcgtcttgagaccttttcatcatggtcattt
ccaattgacaaggaaacactcgctaaagctggattttatagtataggtgacggagatgcc
acaaagtgctttcattgtgggggagtgttaaattgttggtcggcaacagatgatccttgg
gaagagcatgccaaggcatatcctggatgcaagttcctgattgatgaaaagggacagcac
tttataaaccatgcccagttaaagagacccattctacacaaggcaaactctgcagacgca
tcacctgcattacccaaagacagcaatttattgaagagcccattggtgaccgatgcccag
caaatgggatttcctcttgaagaaataaagaaagttatggggcagaagctgaagaccaca
gggaaaaattatacatgtgtggaagaatttgtctctgacttgtgtgctcagaaagaaaca
gttttagagaagcccaaggaaattgagatcagccttgaagagaaactgaggcaactagag
gaggagaagatctgcaaagtttgtatggacaggcggatctccattgttttcataccctgc
ggccaccttgtggcctgtgctgtatgtgcagatgtgcttgataaatgtccaatctgttgc
actattgtagaaagaagacagaaaatttttatgtcatag

DBGET integrated database retrieval system