KEGG   Xenopus tropicalis (western clawed frog): 595004Help
Entry
595004            CDS       T01011                                 

Gene name
pcmt1
Definition
(RefSeq) protein-L-isoaspartate (D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     595004 (pcmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Ubie_methyltran GCD14 PrmA Methyltransf_11 Methyltransf_23 MTS FtsJ Methyltransf_16 Methyltransf_32 Fibrillarin
Motif
Other DBs
NCBI-GeneID: 595004
NCBI-ProteinID: NP_001025616
Xenbase: XB-GENE-959017
UniProt: Q5BKH1
Position
5
AA seq 228 aa AA seqDB search
MAWKSGGASHSELVNNLRKNGIIKSDRVFEVMLETDRRHYAKCNPYMDSPQSIGYQATIS
APHMHAYALELLHDQLHEGAKALDVGSGSGILTACFSRMVGPKGKVVGIDHIKELVDDSI
NNVKKDDTTLLSSGRVKLLVGDGRMGYPEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLDDGSVKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaagtcagggggagccagccactcggagctggtcaacaacctgcgcaaaaat
ggaattatcaaatcagatagagtgttcgaagttatgcttgaaacagatcgccgacattac
gcaaaatgcaatccttacatggactctccacagtcaataggttatcaagcaaccattagt
gcaccacatatgcatgcatatgcactagaacttcttcatgatcagttacatgaaggtgcc
aaagctcttgatgtaggatctggaagtggaattcttactgcatgtttttctagaatggtt
ggcccaaagggaaaagtagtagggattgaccatatcaaagaattagtagatgattctata
aataatgtaaaaaaagatgacacaaccttgttgtcttcaggccgagtaaagctattagtt
ggagatggtagaatgggttacccagaagaagcaccttatgatgctattcatgtaggagca
gctgcacctgttgtaccacaagctctgatagatcaacttaagccaggaggaagattaatc
ttacccgttggtccagctggtggaaaccagatgttggaacaatatgataagctagacgat
ggaagtgtcaaaatgaagcctttgatgggggtgatctacgtgcctttaacagacaaagaa
aagcagtggtccagggatgaattgtaa

DBGET integrated database retrieval system