KEGG   Xenopus tropicalis (western clawed frog): 595026Help
Entry
595026            CDS       T01011                                 

Gene name
cyb5r2
Definition
cytochrome b5 reductase 2 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    595026 (cyb5r2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     595026 (cyb5r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 304 aa AA seqDB search
MEISTDSNMLVALAVIGVTVLLFLIKALGSQAKKAPLTLLDPNAKYPLPLIEKQEISHDT
KKFRFGLPSQEHVLGLPVGQHVYLSAKINGSLVVRAYTPVSSDEVKGHVDLIVKVYYKNV
HPKFPEGGKMSQHLDSLKIGETIDFRGPNGLLVYKEKGKFAIRPDKKSEPKLKVAKHVGM
LAGGTGITPMLQLIRQITQDPNDNTKCSLIFANQTEDDILLRYELETVAKSHPEQFKLWY
TLDRPPQGWKYGAGFVTADMIKEHLPPPSEDVVVLMCGPPPMIQFACQDNLTKLGYPEAG
RFAY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggagatttccacagactctaacatgctggtagccctggcagtaatcggggtaactgtg
ttactgttcctgattaaagcgctgggatctcaggctaagaaagcgccgctcactctgctg
gaccccaatgccaagtacccactacctctcatagagaaacaggaaatcagccacgacacc
aagaaattcaggtttgggctcccctcgcaagagcatgtcttggggctccctgtaggtcag
catgtttacctctctgccaagatcaatgggagcctggtcgttcgggcgtatacgccggtg
tctagtgatgaagtcaagggccacgtggatctgatagtgaaggtatattacaaaaacgtt
catcccaaattcccagagggaggcaaaatgtcccaacacctggacagtcttaaaataggg
gaaacaattgatttccggggtccaaatgggcttcttgtctacaaagagaagggtaagttt
gccatcaggccagataagaagtccgaaccaaagcttaaggtggccaaacatgtcggaatg
cttgccggaggaactggtattacacccatgttacagctgatccggcagatcacccaggat
cccaatgataatacaaaatgctccctcatatttgctaaccagacagaagacgacattttg
ctgcgttatgaactggaaactgtagccaagagccacccggagcagtttaagctgtggtat
acactggatcggcccccgcaaggctggaagtacggcgctggctttgtcaccgcagacatg
attaaagagcacctaccgcccccatccgaggatgtcgttgtgctgatgtgcgggcctcct
cccatgatccagtttgcgtgccaggacaacctgaccaagcttgggtaccccgaggccgga
aggtttgcctactag

DBGET integrated database retrieval system