KEGG   Xenopus tropicalis (western clawed frog): 613056Help
Entry
613056            CDS       T01011                                 

Gene name
ggct
Definition
(RefSeq) gamma-glutamylcyclotransferase
  KO
K00682  gamma-glutamylcyclotransferase [EC:4.3.2.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    613056 (ggct)
Enzymes [BR:xtr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.9  gamma-glutamylcyclotransferase
     613056 (ggct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIG2_2 GGACT
Motif
Other DBs
NCBI-GeneID: 613056
NCBI-ProteinID: NP_001037865
Xenbase: XB-GENE-990757
UniProt: Q28C58
Position
6
AA seq 189 aa AA seqDB search
MEATRVPGLLPEGNSFYYFAYGSNLLKERLLLHNPSASFRCIASLKNFRLAFGNNEGNRI
STWGGGVATVVESQGDEVWGVVWKMDITNLHSLDMQEGVDVGIYEPLEINVQTAEENLPC
RCYQMKKCIFGLSSPQYKQVLCMGAKQNDLPLKYQKMLKEIETNNFSGHIPIMDHLKDAI
EKLQSDMHQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaagctacaagagttcctggtctcctgccggagggtaactctttctactattttgct
tacggcagcaatttactgaaagagcggcttcttcttcacaacccatctgcctccttccgc
tgcattgcctccctcaagaatttcaggcttgcatttggcaataatgaaggcaacaggata
tcaacttggggaggtggcgtagctacagtggttgagagtcaaggagatgaagtctgggga
gttgtatggaagatggacattaccaacctacattccttggacatgcaggaaggtgttgat
gttggtatttatgaaccattagagataaatgtccaaacagctgaggaaaatctcccctgt
cgatgttaccaaatgaaaaagtgcatctttggcctttcttctccacaatacaagcaggtc
ctgtgcatgggagcaaaacagaatgacttaccacttaagtaccagaagatgctgaaagaa
atagaaaccaacaacttctcaggccatattcccattatggaccatttaaaagatgcaatt
gagaaactgcaaagtgacatgcatcagtaa

DBGET integrated database retrieval system