KEGG   Xenopus tropicalis (western clawed frog): 613056Help
Entry
613056            CDS       T01011                                 

Gene name
ggct
Definition
gamma-glutamylcyclotransferase (EC:2.3.2.4)
Orthology
K00682  
gamma-glutamylcyclotransferase [EC:2.3.2.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    613056 (ggct)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.4  gamma-glutamylcyclotransferase
     613056 (ggct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 189 aa AA seqDB search
MEATRVPGLLPEGNSFYYFAYGSNLLKERLLLHNPSASFRCIASLKNFRLAFGNNEGNRI
STWGGGVATVVESQGDEVWGVVWKMDITNLHSLDMQEGVDVGIYEPLEINVQTAEENLPC
RCYQMKKCIFGLSSPQYKQVLCMGAKQNDLPLKYQKMLKEIETNNFSGHIPIMDHLKDAI
EKLQSDMHQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaagctacaagagttcctggtctcctgccggagggtaactctttctactattttgct
tacggcagcaatttactgaaagagcggcttcttcttcacaacccatctgcctccttccgc
tgcattgcctccctcaagaatttcaggcttgcatttggcaataatgaaggcaacaggata
tcaacttggggaggtggcgtagctacagtggttgagagtcaaggagatgaagtctgggga
gttgtatggaagatggacattaccaacctacattccttggacatgcaggaaggtgttgat
gttggtatttatgaaccattagagataaatgtccaaacagctgaggaaaatctcccctgt
cgatgttaccaaatgaaaaagtgcatctttggcctttcttctccacaatacaagcaggtc
ctgtgcatgggagcaaaacagaatgacttaccacttaagtaccagaagatgctgaaagaa
atagaaaccaacaacttctcaggccatattcccattatggaccatttaaaagatgcaatt
gagaaactgcaaagtgacatgcatcagtaa

DBGET integrated database retrieval system