KEGG   Xenopus tropicalis (western clawed frog): 613092Help
Entry
613092            CDS       T01011                                 

Gene name
scd, fads5, scd1, scdos
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    613092 (scd)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    613092 (scd)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    613092 (scd)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     613092 (scd)
Lipid biosynthesis proteins [BR:xtr01004]
 Desaturase
  First
   613092 (scd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 338 aa AA seqDB search
MTFRGSQTVSTVMESPSIIQDEIGADRVMTDDIFDTTYIKKVDFKPPIKLVWRNVILMAL
LHFGAFYGLFMIPAAKPITLAWAILCFMLSALGVTAGAHRLWSHRSYKAKLPLRIFLAVV
NSMAFQNDIYEWARDHRVHHKYSETDADPHNAVRGFFFSHIGWLLMRKHPDVIEKGKKLD
LSDLKADKVVMFQRRNYKLSILVMCFILPTVIPWYFWDESFSVAFYVPCLLRYALVLNAT
WLVNSAAHMYGNRPYDQTINPRENPLVAIGAIGEGFHNYHHTFPFDYSTSEFGLKFNITT
GFIDLMCLLGLANDCKRVSKETIMARKKRTGDGSHRSG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgactttcaggggcagtcagactgtgtcaacagtaatggaaagtccttccataatacag
gatgaaattggggctgacagagtcatgacagatgacatatttgatactacatacattaag
aaagtggattttaagccacccatcaaactggtttggaggaatgtaatcctgatggctctg
ctgcactttggagcattttatggactgtttatgatacctgctgcaaagcccatcactttg
gcatgggcaattctgtgcttcatgttgagtgctcttggggtgacagctggtgcacatcgt
ctctggagtcatcgttcctataaggccaaacttccccttaggatatttttggcagttgta
aactctatggcttttcagaatgacatttatgaatgggcacgagatcaccgtgttcatcac
aaatactctgaaactgatgctgatccacataacgctgtgagaggtttcttcttttcgcac
attggttggcttctcatgcgcaagcaccccgatgtcatagaaaaagggaagaagcttgat
ctaagtgatctcaaagcagataaagtggtcatgttccaaaggagaaattataagctttct
atactggtgatgtgtttcatactccccactgtgattccatggtacttctgggacgagtct
ttctccgttgccttctatgttccttgtctcttacgttacgcactagtgctcaatgcaaca
tggctggtgaatagcgcagctcatatgtatggaaaccgaccttatgaccaaaccatcaat
cccagagagaacccattagtcgctattggagccataggagaaggctttcataactaccat
cacacattcccttttgactattctaccagtgaatttggtctaaagttcaacattaccact
ggctttattgaccttatgtgcctgttaggcctggctaatgactgcaagagggtatccaag
gagaccataatggctcgaaagaagcgcactggtgacgggagccacaggagtggctga

DBGET integrated database retrieval system