KEGG   Xenopus tropicalis (western clawed frog): 613115Help
Entry
613115            CDS       T01011                                 

Gene name
map2k7, MKK7, jnkk2, mapkk7, prkmk7
Definition
mitogen-activated protein kinase kinase 7 (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Toll-like receptor signaling pathway
GnRH signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    613115 (map2k7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    613115 (map2k7)
   04012 ErbB signaling pathway
    613115 (map2k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    613115 (map2k7)
  Endocrine system
   04912 GnRH signaling pathway
    613115 (map2k7)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     613115 (map2k7)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   613115 (map2k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 433 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIELEISPQRPRPIILITLSPTPAPSQRAALQLP
LANDGHSRSDAPSHHHSPLTVRPRTFLSLPQTNYLTQRSMESIEIDQKLQEIIKQTGYLV
IDGQKYPADINDLENLGEIGSGTCGQVWKMRFKKTGHVIAVKQMRRSGNKEENKRILMDL
DVVLKSHDCPYIVQCYGTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIV
NALYYLKEKHGVIHRDVKPSNILLDANGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPE
RIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNM
GFSPLFQSFVKDCLTKDHRKRPKYNKLLEHPFLRRYETTEVDVALWFQEIMARTESPRSS
TLLSPQNLTFFSR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctagaacagaaactctcccgtctggaggcgaaattgaagcaggag
aatagggaggcacggagaagaatcgagcttgagatcagccctcagcggccacggcccatt
attctcatcactctaagtcccacgcccgctccatcccagcgagcagccttacagctccct
ctcgccaatgatggacattcacgttcagacgccccttcccaccatcactctcccctgaca
gtgcggccgagaaccttcctgagtttgccgcagaccaactacctgacgcagcgcagcatg
gagagcattgaaattgaccagaagcttcaggaaattatcaagcagactgggtatttagtt
attgatgggcagaagtacccagcagatatcaatgacctggagaacctgggggagattggc
agcggcacttgtggccaggtctggaaaatgaggtttaagaagacggggcacgtcatcgca
gttaagcaaatgcgtcgttctggaaacaaggaggagaacaagagaattctgatggatttg
gatgttgtactaaagagccatgactgtccgtacattgtgcagtgctatggtaccttcatc
acaaatactgatgtgttcattgcaatggagttaatggggacctgcgctgaaaaactgaag
aagaggattcaggggcccatcccagaggccatcttgggaaagatgactgtggctatagtt
aatgctttgtattatctgaaagagaaacatggtgttatacacagagatgttaaaccctct
aacatcctgctcgatgccaatgggcagatcaaactgtgtgactttggaatcagtgggcgc
cttgtggactcaaaggcaaagacaaggagtgccggctgtgctgcttatatggcgcctgag
cgaattgaccctcccgacccaaccaaaccagactacgacatccgcgcagatgtatggagt
ttggggatctccctggtggagttggccaccggacagtttccctacaaaaactgtaagact
gattttgaggttctcaccaaagttctccaagaagagccacccgtactcccccacaatatg
ggcttctccccattatttcagtcatttgttaaggactgtcttactaaagatcacagaaag
aggccaaagtacaataagctgctggagcacccattcctgcgtcgttatgagacaactgaa
gtagatgttgccttgtggtttcaggagatcatggctaggacagaatcccccaggagcagc
acactcctcagcccccaaaacctgacattttttagcaggtag

DBGET integrated database retrieval system