KEGG   Xenopus tropicalis (western clawed frog): 733468Help
Entry
733468            CDS       T01011                                 

Gene name
tmsb4
Definition
thymosin, beta 4
Orthology
K05764  
thymosin, beta 4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xtr04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 42 aa AA seqDB search
MSDKPDMAEIEKFDKTKLKKTETQEKNPLPSKETIEQEKATS
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaccagatatggctgagattgagaaatttgataagaccaagctgaagaag
acagaaacacaagaaaagaacccactcccatcaaaagaaacgattgagcaagagaaagca
acttcataa

DBGET integrated database retrieval system