KEGG   Xenopus tropicalis (western clawed frog): 733468Help
Entry
733468            CDS       T01011                                 

Gene name
tmsb4x, ptmb4, tmsb4
Definition
(RefSeq) thymosin beta 4, X-linked
  KO
K05764  thymosin, beta 4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    733468 (tmsb4x)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     733468 (tmsb4x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin WH2 DUF4522
Motif
Other DBs
NCBI-GeneID: 733468
NCBI-ProteinID: NP_001037883
Xenbase: XB-GENE-6258559
UniProt: Q28EW7
Position
2
AA seq 42 aa AA seqDB search
MSDKPDMAEIEKFDKTKLKKTETQEKNPLPSKETIEQEKATS
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaccagatatggctgagattgagaaatttgataagaccaagctgaagaag
acagaaacacaagaaaagaacccactcccatcaaaagaaacgattgagcaagagaaagca
acttcataa

DBGET integrated database retrieval system