KEGG   Xenopus tropicalis (western clawed frog): 733548Help
Entry
733548            CDS       T01011                                 

Gene name
josd2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     733548 (josd2)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C86
   733548 (josd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 184 aa AA seqDB search
MTESVFHERQRLELCAVHALNNLLQKPEFSHQRAEEICRGLAPNSMINPHRSLLGTGNYD
VNVIMAALQTMDYAAVWWDKRRSLESLVLSEIFGFILNIPSPVSLGFLSLPITRKHWIAV
RQIEGVYYNLDSKLKAPVKLGGPKELKEFLHGCISRGSCEILLVVRRDVEDARLWISTEE
QAGT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtcggtgttccatgagcggcagcggctggagctgtgcgctgtccatgccctc
aataaccttctgcagaaaccggagttcagtcaccagagggctgaggagatctgccgggga
ctcgctccaaactctatgattaaccctcaccgcagtcttctgggtaccggcaattacgat
gtcaacgtcattatggcagctcttcaaactatggactatgcagcggtttggtgggacaaa
cggagatccctggagagtctggttctaagtgagatctttggcttcatccttaatattcca
tctcctgtttctctgggattcctctccctgcccatcacacgcaaacactggatcgctgtg
cgacagatcgaaggtgtttactacaacttggactccaagctgaaagcaccagtcaaactt
ggtggcccaaaggagttaaaggagtttctgcatggctgcatctcaagaggctcctgtgag
atcctgctggtggtccggagggacgtggaggatgcccggctgtggataagcacagaggag
caggcagggacatga

DBGET integrated database retrieval system